Sitemap for Women Collections
Chie Mihara Cafra T-strap platform sandals Grey CAFRA48,
Pedro Miralles eyelet-embellishment mules Black 18534,
biancadi zip-fastening boots Black 475,
Pedro Miralles leather mules Red 18737,
Pedro Miralles pointed-toe mules White 18635,
EDDI CUOMO glass-embellished T-strap sandals Gold T7682,
EDDI CUOMO glass-embellished sandals Pink T7682,
Chie Mihara T-strap metallic sandals Neutrals BABI48,
Pedro Miralles pointed-toe mules Black 18596,
Chie Mihara woven platform sandals Gold CANETI48,
Chie Mihara T-bar strap sandals Gold LILUCE,
EDDI CUOMO circle-embellished mules Gold B305666,
Chie Mihara t-strap circle-embellished sandals Gold RYCUSE,
Pedro Miralles eyelet-embellishment mules White 18534,
Chie Mihara round embellishment sandals Red URANA,
biancadi studded-embellishment slingback pumps Brown 2481,
Pedro Miralles pointed-toe pumps Black 18737,
Chie Mihara woven strap sandals Neutrals RUCINA,
EDDI CUOMO glass-embellished T-strap sandals Gold T3685,
TWINSET ribbed-knit pointelle-trim top Neutrals 261TT3122,
Polo Ralph Lauren cable-knit short-sleeved cardigan Blue 211963486500,
Jan Jan Van Essche Urushi hemp canvas tote bag Grey BAG44URUSHIHEMPCANVASPITCH,
Polo Ralph Lauren striped-pattern tie-waist midi shirt dress White 211965843501,
Nanamica zip hooded jacket Neutrals S26SA004E,
Agnona bermuda shorts Red T81101XD1024,
Agnona asymmetric maxi skirt Brown TG1102YU2112,
Orlane pinstripe trousers Blue JOGGERINJERSEYSTRIPES,
Orlane long-sleeve shirt Neutrals UNISEXSHIRTLOROPIANA,
Nanamica Pocket logo shirt Neutrals S26SG082E,
Nanamica regular collar shirt Neutrals S26SG088E,
Nanamica striped T-shirt Grey S26ST037E,
Nanamica regular collar wind shirt Brown S26SG059E,
Nanamica regular collar shirt Blue S26SG082E,
Missoni short-sleeve T-shirt Neutrals DS26SL01BR014W,
Orlane long-sleeve cotton shirt Blue BOYFRIENDSHIRT,
Agnona button coat Green TL1103AD1026,
P.E Nation logo-embroidery T-shirt Green 23PE1T014,
The North Face Essential hoodie Grey NF0A89ENDYX,
The North Face Essential relaxed straight joggers Grey NF0A8C1GDYX,
P.E Nation Magnitude short-sleeves training top Black 244C216,
The North Face Glacier fleece sweatshirt Grey NF0A8D2FCQI,
P.E Nation ribbed logo-embroidered crop top Green 22PE1W077,
P.E Nation logo-embroidered baseball cap Black 22PE2A050,
Rains mini Box crossbody bag Neutrals 14120,
The North Face TNF™ Celebration relaxed crew graphic sweatshirt Grey NF0A8GATDYX,
The North Face Reaxion 2.0 joggers Black NF0A8DWAKS7,
The North Face Base Camp Voyager logo-print pocket-detail tote bag Black NF0A81BM,
Rains logo-tape mesh-panel backpack Grey 12790147,
The North Face Essential sweatshirt Neutrals NF0A89EPQLI,
P.E Nation Flyaway colourblock logo shorts Pink 22PE1S089,
P.E Nation logo-detail T-shirt Orange 22PE1T152,
The North Face Base Camp Voyager front-pockets tote bag Blue NF0A81BM9261,
TWINSET leather sliders with logo Black 261TCP038,
Rains logo-debossed belt bag Neutrals 14100111,
The North Face Explore Camp sandals Black NF0A8ADRKX7,
The North Face Glacier fleece jacket Blue NF0A8D2F8K2,
DRIES VAN NOTEN open gem ring Silver 2610182950063,
DRIES VAN NOTEN small leather bag Black 2610115620116,
DRIES VAN NOTEN embroidered blazer Neutrals 2610104203103,
CHANEL Pre-Owned 2003-2004 Chocolate Bar Lambskin Reissue 2.55 shoulder bag Black SRV6ZOF0QR10OXG6,
Gucci Pre-Owned 2016-2025 GG Supreme Blooms Dionysus Wallet on Chain crossbody bag Brown PFJ1G15P7KFRIR5F,
The North Face Mountain Athletics full-zip hooded fleece jacket Yellow NF0A8DXXG73,
P.E Nation cotton T-shirt Grey 23PE1T034,
RRR123 Membership Uso logo-print hoodie Grey MUSOHD00,
RRR123 Moda Apocrypha Quad Tee graphic-print T-shirt White MDAQSS90,
HOKA One One Speedgoat 2 trail running sneakers Blue 1162710,
Y-3 logo slides Black KI4033,
DRIES VAN NOTEN sequin-embroidered cotton jacket Green 2610105553103,
DRIES VAN NOTEN long-sleeve T-shirt Grey 2610111323606,
DRIES VAN NOTEN jacquard-pattern jacket Green 2610105553154,
DRIES VAN NOTEN embroidered shorts Green 2610109803103,
Bottega Veneta Pre-Owned 2012-2025 Lambskin The Mini Pouch crossbody bag Brown PNSNU9KB44JLA85K,
Gucci Pre-Owned 2000-2015 GG Canvas Web travel bag Brown KQTJY60V1A8W6WZK,
norda lace-up sneakers Neutrals 001AW,
Christian Dior Pre-Owned 2020 Oblique Canvas Saddle belt bag Blue 4NTUXET3PJH452OX,
Andersson Bell stud-embellished asymmetric denim jacket Black AWA762U,
adidas Chile Handball Spezial sneakers Brown HQ9439,
PINKO ribbed tank top Black 105001A2IA,
PINKO logo-print triangle bikini top Blue 101038A0S4,
Charles Jeffrey Loverboy rabbit-ear hat Black 52130202BLK,
Charles Jeffrey Loverboy Mini marshmallow bag Black MINIMARSHMALLOWBAG,
Elisabetta Franchi hooded maxi dress White AB96165E3,
Elisabetta Franchi sequin-embellished maxi dress Black AB96565E3,
Elisabetta Franchi sequin-embellished maxi dress Green AB96465E3,
Elisabetta Franchi logo-engraved earrings Gold OR05B63E2,
Maison MIHARA YASUHIRO Oliver graffiti-print sneakers Blue A16FW705,
Hermès Pre-Owned 2021 Canvas H GM tote bag Brown SL8MMKZ77IG146ZE,
Loewe Pre-Owned 2010-2026 XS Military Messenger Bag crossbody bag Grey BBUWC20FY13T5N7T,
Burberry leather Hobby Horse charm Pink 8125194,
Burberry Check bikini top Neutrals 8124688,
Loewe Pre-Owned 2010-2026 Smooth Calfskin Pebble Pouch crossbody bag Black HG4ZAV2MJY5K28ET,
Bottega Veneta Pre-Owned 2012-2026 Leather crossbody bag Red CFXC223P756GQ6E1,
Gucci Pre-Owned 2016-2026 Medium GG Emblem Leather shoulder bag Black IEO15OSV4EHENFJ1,
Christian Dior Pre-Owned 2010-2026 Cannage Delices satchel Purple EOWE66WBO06YRS9N,
CHANEL Pre-Owned 2005-2006 Lambskin Cambon Ligne Bowling Bag shoulder bag Brown LUCK27KS0Q29GG8W,
Celine Pre-Owned 2014 Micro Leather Luggage Tote handbag Orange MP3MLGHP3NV9ZW7F,
R13 painted embellished sneakers Neutrals R13S5029,
PARAMIDONNA Daisy crystal-embellishment bikini Black LC26DBL,
Andersson Bell Rigid skirt Blue APA913W,
PINKO ribbed tank top Pink 105001A2IA,
PINKO Love Birds-print bikini Red 101044A0S6,
Prada Pre-Owned 2010-2026 Canapa Logo Jacquard crossbody bag Brown 49ORVMT40OW6NDMP,
Burberry small Rider bag Neutrals 8125491,
Christian Dior Pre-Owned 2010-2026 Mini Oblique Canvas Saddle Bag handbag Brown AIW9PW4PQDEF9A54,
Yu Mei Antonia leather shoulder bag Brown 09421034805347,
Yu Mei Bobby suede shoulder bag Brown 09421034805408,
Yu Mei Claudia zip-fastening tote bag Black 09421034804944,
Yu Mei Brooke leather shoulder bag Brown 09421034805354,
Yu Mei Georgie leather cross body bag Brown 09421034805361,
Yu Mei suede tote bag Brown 09421034805385,
Yu Mei suede keyring Brown 09421034805415,
Yu Mei Envelope button-fastening cardholder keyring Brown 09421034805422,
Prada Pre-Owned 2010-2026 Canapa Logo Jacquard crossbody bag Brown XY9KHK0WWBUKYA8D,
Hermès Pre-Owned 2016 Mini Evercolor Convoyeur crossbody bag Blue GMRVF1UECBJA37WM,
Dorothee Schumacher Sporty Romance polo shirt Blue 428402,
Dorothee Schumacher Sporty Romance short-sleeve polo shirt Blue 428402,
Roberto Collina cut-out ribbed-knit top Black 261FXA31201,
Dorothee Schumacher Sporty Romance polo shirt White 428402,
Jacquemus The J cardigan Blue CDW00827AK00299,
LB Exclusive halo-set diamond and opal ring Gold MF35030226,
LB Exclusive emerald and diamond ring Silver MF37030226,
LB Exclusive sapphire and diamond ring Gold MF16030326,
LB Exclusive multi-stone ring Gold MF21030226,
LB Exclusive wave diamond ring Gold MF40030326,
LB Exclusive wide-band diamond and emerald ring Silver MF30030326,
LB Exclusive floral-motif diamond and emerald ring Pink MF33030226,
LB Exclusive diamond and ruby ring Gold MF20030326,
LB Exclusive diamond ring Gold MF04030326,
LB Exclusive round-cut diamond and peridot ring Gold MF34030326,
LB Exclusive diamond and emerald ring Silver MF06030226,
LB Exclusive diamond and opal ring Silver MF36030226,
LB Exclusive diamond ring Silver MF29030326,
LB Exclusive LB Exclusive 18K Yellow Gold 2.80ct Emerald Ring MF30-030226 Gold MF30030226,
LB Exclusive emerald and ruby ring Silver MF05030226,
LB Exclusive diamond brooch Pink MF39030226,
LB Exclusive diamond ring Gold MF11030326,
LB Exclusive diamond and sapphire ring Silver MF14030326,
LB Exclusive diamond and sapphire ring Gold MF35030326,
LB Exclusive heart-cut diamond ring Silver MF17030326,
LB Exclusive diamond and emerald ring Gold MF16030226,
LB Exclusive diamond ring Silver MF41030326,
LB Exclusive Edwardian diamond brooch Silver MF10030326,
LB Exclusive diamond and sapphire ring Silver MF21030326,
LB Exclusive bow diamond and ruby brooch Silver MF25030326,
LB Exclusive rose-cut diamond and emerald cocktail ring Silver MF17030206,
LB Exclusive diamond ring Gold MF02030326,
LB Exclusive diamond and tourmaline brooch Gold MF06022626,
LB Exclusive flower-motif diamond ring Gold MF26030226,
LB Exclusive diamond ring Silver MF22030226,
LB Exclusive diamond and emerald ring Gold MF24030226,
LB Exclusive diamond ring Gold MF27030226,
LB Exclusive diamond ring Silver MF330303126,
LB Exclusive diamond and emerald ring Gold MF31030326,
LB Exclusive diamond and ruby band ring Gold MF32030226,
LB Exclusive diamond ring Silver MF08030326,
LB Exclusive diamond clip-on earrings Silver MF09030326,
LB Exclusive diamond and emerald ring Silver MF19030326,
LB Exclusive diamond and sapphire ring Silver MF29030226,
LB Exclusive floral-motif diamond brooch Silver MF05022626,
LB Exclusive diamond and emerald pearl drop earrings Pink MF24030326,
LB Exclusive floral diamond brooch Pink MF01030326,
LB Exclusive rose-cut diamond drop earrings Gold MF38030326,
CLEA Pepe mini dress Neutrals 1612,
CLEA Kya embroidered midi dress Brown 1661A,
CLEA Annalise shirt dress Blue 1619,
CLEA Kya embroidered midi dress White 1661,
Biyan Ferna taffeta trousers Neutrals PBFW25005,
Herno drawstring-hem V-neck top Blue BL000053D12483Z,
Louis Vuitton Pre-Owned Cluny Top Handle Bag Monogram Canvas BB satchel Brown ZLS2DVLIQ8DN9YX1,
Saint Laurent Pre-Owned Belle de Jour Leather Large clutch bag Pink Z2RWV1N657DAA95F,
Louis Vuitton Pre-Owned Naviglio Handbag Damier crossbody bag Brown YBU4DMAIZQ5UU1GD,
Forte Forte elastic-waist maxi skirt Pink 14887MYSKIRT,
Gucci Pre-Owned Blondie NM Handle Bag Leather Medium crossbody bag Black ODPOTZ5GEUUDCL0C,
Biyan beaded-neckline fil-coupé dress Black DBFW25020,
Biyan Indara velvet-appliqué cape dress Blue DBFW25021,
Biyan floral-jacquard straight-fit trousers Pink PBSS25002,
Biyan embroidered shirt Neutrals BBSS25002,
The Attico asymmetric stripe midi skirt Pink 260WCS00298367,
Goyard Pre-Owned Saigon Top Handle Bag Coated Canvas with Leather PM satchel Green ZAIIODI6WBTOI66I,
CHANEL Pre-Owned Gabrielle Quilted Aged Calfskin Small hobo bag Red YX3DNVVFG7IOI0A0,
Prada Pre-Owned Triangle Logo Drawstring Pouch Velvet Mini bucket bag Black YMV0E45N9CVRRJDC,
Celine Pre-Owned Belt Bag Textured Leather Nano shoulder bag Pink XLDOXL47D2E7NW6R,
Chloé Pre-Owned Faye Leather Medium shoulder bag Neutrals MI3K5CG54R3LJ46M,
Balenciaga Pre-Owned Duty Free Leather North South tote bag Black MABMBKEVDN07A0VD,
Louis Vuitton Pre-Owned Twist Handbag Epi Leather MM crossbody bag Red WB0VEBQ31EY2XWNV,
CHANEL Pre-Owned Casual Trip Messenger Bag Quilted Lambskin Mini crossbody bag Blue WDM8BO9I62QFOF30,
Gucci Pre-Owned x Balenciaga The Hacker Project Hourglass Top Handle Bag GG Coated Canvas Small shoulder bag Brown ULQEHSXVADJBCPPU,
Louis Vuitton Pre-Owned OnTheGo Tote Bicolor Monogram Empreinte Giant MM shoulder bag Black T2SA6GI50958POGV,
Prada Pre-Owned Shopper Nappa Antique Medium tote bag Grey KU8Y9DRS4GN4AHYF,
Evaluna round-toe studded pumps Black FA02,
Hemant And Nandita Dani paisley-print ruffled top Neutrals HNDANI6194,
Hemant And Nandita floral-print dress Green HNCOVE6013,
Evaluna stud-embellishment sandals Neutrals 5922B,
Stella McCartney V-neck asymmetric dress Red 6A06973FU302,
Prada Pre-Owned Cuir Double Saffiano Leather Medium tote bag Blue JH4HAE8AZ6ZHBLFM,
Gucci Pre-Owned Ophidia Chain Shoulder Bag Leather Small crossbody bag Neutrals J7O202WDSSLT0OPL,
Louis Vuitton Pre-Owned Greta Handbag Monogram Multicolor hobo bag Black BX8BLN83AN94U4CL,
Louis Vuitton Pre-Owned Neverfull Monogram Canvas MM tote bag Brown ICOHH5BNJ62UN0HL,
Gucci Pre-Owned Ophidia GG Coated Canvas Medium backpack Brown HU1LLJZMHP62R102,
Gucci Pre-Owned Queen Margaret Top Handle Bag GG Coated Canvas with Leather Small satchel Brown AXDUJCGQSVL3S6TS,
Loewe Pre-Owned Madrid Shoulder Bag Leather Medium tote bag Pink HQB749EBKZLYLYKK,
Louis Vuitton Pre-Owned Felicie Pochette Monogram Canvas crossbody bag Brown H88KF8YHG0GL4G0I,
Gucci Pre-Owned Blondie Diagonal Quilted Leather Small shoulder bag Black H5XPL4KHJKS97EX4,
Gucci Pre-Owned x Balenciaga The Hacker Project Hourglass Top Handle Bag GG Coated Canvas Small shoulder bag Brown 8N34ACWOW123W416,
Goyard Pre-Owned Saigon Top Handle Bag Coated Canvas with Leather Mini shoulder bag Blue EVXB2RRCN84MPCS2,
Celine Pre-Owned Tricolor Luggage Bag Leather Micro tote bag Multicolour EIQUE952U8H0IVWS,
Goyard Pre-Owned Anjou Reversible Tote Coated Canvas Mini satchel Grey EH9A1JCKKFHWKFRP,
Louis Vuitton Pre-Owned Turenne Handbag Monogram Canvas PM satchel Brown E9D4UAWUTW9SJ77Q,
Prada Pre-Owned Symbole Shopper Tote Jacquard Mini crossbody bag Black 78T5KO5EJHI0MJ9D,
CHANEL Pre-Owned Trompe L'Oeil CC Evening Bag Sequins tote bag Silver 7AOIUUANKKL7HJQI,
Louis Vuitton Pre-Owned Sac Plat NM Bag Monogram Canvas BB tote bag Brown DNURGMDW1Z315VJR,
Gucci lace platform sneakers Neutrals 854439FAFZ4,
Jil Sander cropped ribbed-knit sweater Grey J03GP0191J14837,
Alexander McQueen double-breasted peaked-lapel jacket Black 859971QJAAC,
Louis Vuitton Pre-Owned Petite Malle Handbag Limited Edition Patches Monogram Canvas crossbody bag Brown CCAX2ANDWQX58FSK,
Hermès Pre-Owned Evelyne Bag Gen III Clemence GM crossbody bag Orange OT7D6PQ0FUHST8QH,
Prada Pre-Owned Adjustable Handle Zip Saffiano Leather Mini hobo bag Black 48JY4YIVJP9Q9B2B,
Hermès Pre-Owned Carrying Dog Bag Canvas travel bag Green 47K4OTIRX6X3AYCK,
Woolrich buttoned striped shirt Blue CFWWSI2021FRUT5378,
Woolrich poplin dress Green CFWWDR2028FRUT3944,
Saint Laurent Pre-Owned Sac de Jour Bag Leather Small satchel Pink 45GO6IMDIAK0AVR0,
Christian Dior Pre-Owned Book Embroidered Canvas Medium tote bag Blue 3HYSDTNWRBY8UKRY,
NISSA embroidered waistcoat Black V16427,
NISSA floral-embroidered jacket Black J16443,
NISSA striped midi dress Neutrals RZ16465,
Goyard Pre-Owned Saint Louis Coated Canvas GM tote bag Black 2GZ5YPSHRR5WOZMF,
Louis Vuitton Pre-Owned Palm Springs Monogram Canvas MM backpack Brown VXO11XZ1M2U9NQJ5,
Louis Vuitton Pre-Owned Bum Bag Monogram Canvas belt bag Brown UW0WSFEULREODKWZ,
Celine Pre-Owned Classic Box Bag Smooth Leather Medium crossbody bag Red TMBXGWWRZ2AREK18,
Celine Pre-Owned Triomphe Shoulder Bag Canvas with Leather Medium crossbody bag Neutrals T77QFZSRWT4SZPHJ,
Celine Pre-Owned Belt Bag Textured Leather Nano shoulder bag Yellow KB1U6DAR2GBPVB6T,
Louis Vuitton Pre-Owned Verona Handbag Damier MM shoulder bag Brown RV273Y0IBSFVF0Q5,
Stella McCartney padlock-detail clutch bag Neutrals 7P0083WP0707,
IRO Sorenza twist-detail linen T-shirt Red WM19SORENZA,
Evaluna stud-embellishment sandals Red 5922B,
Stella McCartney open-back maxi dress Pink 6A06873FU302,
Evaluna square-toe embellished sandals Yellow 5922S,
Goyard Pre-Owned Saint Louis Coated Canvas GM tote bag Brown BHQLXEZCWOKHFSKC,
Gucci Pre-Owned GG Marmont Flap Bag Matelasse Leather Small crossbody bag Multicolour ATSMXQS02Q9J8RIJ,
Gucci Pre-Owned Luce Canvas Small shoulder bag Blue AOSELEI1TTNMBQ31,
CHANEL Pre-Owned CC Kisslock Frame Clutch with Chain Quilted Lambskin Mini crossbody bag Black A9VNGX7PZCUTWTV0,
CHANEL Pre-Owned Gabrielle Quilted Aged Calfskin Small hobo bag Neutrals A1SBQY7HXPNTKXSM,
Louis Vuitton Pre-Owned Explorer Briefcase Monogram Eclipse Canvas business bag Black FXAXF6T7ZFG9Y3LD,
Saint Laurent Pre-Owned Sunset Leather Medium crossbody bag Black FTR0I3ZX3IINS2U8,
Celine Pre-Owned Belt Bag Textured Leather Mini shoulder bag Blue 998D8P5ZWE6VQ1E9,
Celine Pre-Owned 16 Top Handle Bag Smooth Calfskin Medium satchel Grey 8DFT57IKZ9EE2P8S,
CHANEL Pre-Owned Boy Coin Purse with Chain Quilted Caviar Mini crossbody bag Black 8388KO8TNAR4IMVU,
Louis Vuitton Pre-Owned Pochette Metis Reverse Monogram Canvas crossbody bag Brown 63IQ609H4MP4ZB8K,
PT Torino printed satin wide-leg trousers Green CDVSLRZ00STDER21,
Valentino Garavani Upvillage crosta sneakers Pink WS0IL9LAL,
Saint Laurent Jamie 4.3 quilted chain mini bag Black 806025AAB32,
FENDI FFold two-tone ffold leather sandals Neutrals 8X8984AWL8,
LOIS JEANS wide-leg jeans Blue 32277918,
Saint Laurent 110mm Kirat sandals Orange 859308AAF3F,
PT Torino wide-leg corduroy trousers Neutrals CDVSLRZ00STDDV14,
Saint Laurent Babylone chain sandals Pink 8206090NLQQ,
sacai ruffled shirt White 2608327,
Off-White logo-detail hoodie Black 2BB035S26FLE003,
Alexander McQueen Boxe sneakers Neutrals 868495WIAKD,
Louis Vuitton Pre-Owned Pochette Metis Reverse Monogram Canvas crossbody bag Brown DDTMPIUU78YXEVHM,
Louis Vuitton Pre-Owned Palm Springs Monogram Canvas Mini backpack Brown PWBID0OX6EE8GK42,
Gucci Pre-Owned Horsebit 1955 Shoulder Bag Wool Mini crossbody bag Red P6J95CWDDIFIBCAZ,
Louis Vuitton Pre-Owned OnTheGo Tote Bicolor Monogram Empreinte Giant MM shoulder bag Black P1MMGXPYW9RIJW1B,
Louis Vuitton Pre-Owned Felicie Pochette Monogram Empreinte Leather crossbody bag Red C70VXV9RI7E9FGD5,
TELERIA ZED Alessia cuffed trousers Brown ALESSIAM16A,
TELERIA ZED Alessia turn-up trousers Neutrals ALESSIAM16A,
TELERIA ZED Alessia cuffed trousers Blue ALESSIAM16A,
Gucci Pre-Owned Dionysus Bag Blooms Print GG Coated Canvas Small shoulder bag Brown 3N5T6NZMH4LF149H,
NISSA floral-embroidered trousers Black P16442,
NISSA striped cotton jacket Neutrals J16495,
NISSA embroidered midi skirt Black F16440,
Bottega Veneta Pre-Owned Cassette Chain Padded Maxi Intrecciato Leather crossbody bag Black 2B7A7W5HIO73V97C,
Louis Vuitton Pre-Owned OnTheGo Reverse Monogram Giant MM tote bag Brown 1PDYHG9E0Z9Y97TE,
Louis Vuitton Pre-Owned Pochette Metis Monogram Empreinte Leather crossbody bag Blue 1KFGRKQOA8YMR2WT,
Barena pocket V-neck gilet Yellow GLD5519,
A.P.C. Jean shoulder bag Neutrals PXBGOF61242,
Thom Browne RWB stripe Bolton bag in soft pebble grain leather White FAP517AL0105,
Thom Browne Repp stripe tweed pouf tweed cropped jacket White FBR067TF1202,
Maje short satin dress White MFPRO04602,
ISABEL MARANT Alvina bikini bottoms Orange SL0030FAD2P01I,
Reebok Yoga Graffiti sports bra Black S93805,
MARCCAIN Rethink Together T-shirt Neutrals AC4832J48,
Gucci logo-band sandals Neutrals 854415FAECG,
Iceberg diamond-patterned round-neck sweater Neutrals A0227074,
Circolo 1901 double-breasted blazer Brown FD37228262,
POC Fovea ski goggles White 40840,
Vivienne Westwood Free World printed silk scarf Neutrals 81030034W01FV,
TWINSET crochet ballet mules Brown 261LMT014,
ISABEL MARANT Flaviana bikini bottoms Orange SL0019FAD2P01I,
TWINSET mesh stitch cardigan and top Neutrals 261AT3024,
Urbancode double-breasted jacket Neutrals BJ19933098,
sacai round-handle shoulder bag Black S14701,
Urbancode belted patch-pockets jacket Brown BJ20316098,
Amazuìn wide-leg trousers Black GLADYSDEEPBLACK,
MARCCAIN V-neck knitted top Green AC4135M25,
Marella Bianca embellished T-shirt White MLSSAIO2613971044200002,
MARCCAIN Silea jeans White AP8257D12,
Thom Browne Rwb grosgrain chain belt Gold FCX023A01763,
ERMANNO FIRENZE wide-leg trousers Grey D48EP058E5BMF062,
Golden Goose double-breasted blazer in dove-gray chevron wool blend Brown GWP02332P002328,
Max Mara square-buckle wide belt Black 2614501012600,
Givenchy draped long dress Black BW22NU61UJ,
Chloé Kick logo-detail sneakers Neutrals CH26U15RWS,
Thom Browne wool seersucker cropped jacket Grey FBR067B06455,
Carrer Cercs Twill shirt jacket Neutrals CERSTWILLOVERSHIRTBG,
Moncler Hiengos hooded drawstring parka Neutrals L10931C0001853A5E,
FARM Rio tropical-print blouse Neutrals 359524,
Chiara Ferragni detail-embroidered sweatshirt Black 77CBIT01CFT03,
TRUDON Abd El Kader diffuser 350 ml Green ABDELKADERDIFF350ML,
Versace cotton-terry jacquard tote Green 10246191A17767,
Dorothee Schumacher Furry Fantasy curly-sheepskin ballet flats Brown 250703,
Charo Ruiz Ibiza Dafelle lace button maxi dress White 261620,
Paul Smith double-breasted blazer Brown W1R369JUV01427,
Chloé ruffled long-sleeve blouse Neutrals CH26UH101332,
Thom Browne striped pleated skirt Green FGR082TF1200,
MARCCAIN Frenda flared jeans White AP8258D50,
Swedish Stockings Sofia leopard-print tights Neutrals SOFIAMIXED,
MARCCAIN zip-up polo shirt Green AS4859J58,
ZIMMERMANN Luna floral-print bead-embellished midi dress Black 6347DS261,
Lacoste Spinor low-top sneakers White 51SFA0036,
Ermanno Scervino large floral-embroidered leather tote bag Neutrals D483S305RFYK14800,
MARCCAIN Warri wide-leg jeans Blue AP8236D07,
Thom Browne ribbon tweed raglan coat White FOR114BF1192,
Simone Rocha draped embroideredl shirt White 5405B1287,
HOKA patterned sneakers Neutrals 1175490D098,
Janessa Leone Felix bucket hat Neutrals SS26550,
Ferragamo Gancini buckle leather belt Black 230346,
Thom Browne armband poplin shirt Pink FLR005CF1004,
Thom Browne striped sheer tweed jacket Green FBR067TF1200,
Doucal's python-print buckle leather shoes Black DD8877MEGNUF277NN00,
Nanushka Asger balloon jacket Neutrals NU25PFJK10166,
VEJA V-15 panelled sneakers Neutrals VQW021270NEW,
Cambio elasticated-waist wide-leg jeans Blue 9181009200,
BOGNER whiskering-effect jeans Blue 16039151,
sacai zip shoulder bag Black S16301,
Chloé rose-print swimsuit White CH26UMB23333,
Lacoste Spinor sneakers Blue 51SFA0036,
Doucal's openwork tassel loafers Neutrals DD8875MEGNUZ280NM20,
TOTEME raw edge trousers White 262WRB0488FB0623047,
MARCCAIN Ruma jeans Blue AP8249D22,
Marine Serre layered mesh flock dress Black WJS028ACJER0005BK99,
Marine Serre second skin high-waisted closed-feet plumetis tights Black WUW034ACJER0107BK99,
Herno drawstring-waist trousers Neutrals PT000222D126891985,
Charo Ruiz Ibiza Dafelle embroidered dress Black 261620,
BARROW Canotta tank top Black S6BWWOTA140,
Undercover x Emma Bennet floral-print hat Black UC1F4H072,
JW Anderson openwork bow-detail top Neutrals KW1469YN0309,
Autry zip-up hoodie Black HIPXD098,
RE/DONE buttoned straight jeans Blue 14103WWDTAPE,
Emporio Armani button five-pockets jeans White EW000758AF14857U,
Versace Home Medusa head-motif bath towel Blue 10242141A177672U2I0,
Charo Ruiz Ibiza Serza lace skirt White 261402SERZAWHITE,
ZIMMERMANN Alchemy floral-print mini dress Brown 7562DS262R,
MARCCAIN knot animal print blouse Neutrals AC5143W58,
Saint Laurent logo bracelet Gold 850567AAF9R,
Autry zip-up hoodie Yellow HIPXD098,
Self-Portrait tiered drop earrings Gold SS26643EAGD,
FRAME crew-neck T-shirt Green WF25JKT021,
Incotex belt-loop trousers Black 177832D6314,
Simon Miller Pia striped poplin trousers Red W5209317096595,
Givenchy chain link asymmetrical earrings Gold BF116KF003,
TWINSET midi poplin skirt with print Neutrals 261LL2TBB,
Furla white shoulder bag White WB01978ARE000,
Saint Laurent double-breasted blazer Orange 859390Y6J75,
ASPESI pleated elasticated skirt Blue 2286C118098,
Paul Smith suede panelled sneakers Blue W1SDVR08PSUE,
Paul Smith striped scarf Neutrals W1A250CU953,
Marella embellished shirt White MLSTESO2613111114200004,
Chloé small Paddington padlock leather tote bag Neutrals CH26SS805P75,
Emporio Armani quilted logo-plaque tote bag Black EW003825AF22792,
Vivienne Westwood Orb-print scarf Neutrals 81030033W01G1,
Versace terry jacquard Medusa bath towel Brown 10242141A17767,
MARCCAIN ‘Knitted in Germany' ribbed midi dress Pink AS2132M22,
The North Face half-zip sweater Neutrals NF0A8E79,
Doucal's woven loafers White DD8875MEGNUZ280NW00,
FARM Rio Florart mini dress White 348370,
Maje layered linen blend shorts Grey MFPSH00761,
DKNY studded jeans White DJ6B4208,
PUMA Deva reptile-effect sneakers Neutrals 371198,
Reebok racerback logo bra Red AY0972,
Herno drawstring-waist midi dress Neutrals AB000032D52056,
Furla Divide It charm tote bag Black WB02038BX4467,
Thom Browne seersucker jacket White FBR067EF1188,
GANNI wrap scarf in print Neutrals B3020231,
Salomon XA Pro 3D sneakers Neutrals L49172000,
Max Mara MXACAMICE scarf Neutrals 4541226106600,
Gold Hawk lace-trimmed slip dress Grey GH651C23,
Max Mara Adepto ruffled maxi skirt Black 2611101273600,
Max Mara ruffled dress Black 2611321013600,
Gold Hawk lace-trim camisole top Black GH4502,
MC2 Saint Barth Emilie bead-embellished T-shirt White EMI0001,
Gold Hawk Coco Bodice lace-trim slip dress Brown GH987,
Fusalp Orion zip-neck base layer Black 23HE1202,
Fusalp button-fastening pants Blue 24EF1510,
Fusalp printed biker collar bomber jacket Blue 24EF1007,
Fusalp diamond-pattern zip-neck T-shirt Blue 24EF1113,
Fusalp button-shoulder sweater Neutrals 24EF1115,
Fusalp zip-up cuffed jumpsuit Black 24EF1302,
Fusalp ribbed-knit sweater Black 24EF1115,
Kuboraum geometric-frame sunglasses Black P20,
Forte Forte button-fastening trousers White 14951MYPANTS,
Samantha Sung Audrey floral midi dress White AUDREYDRESSSHIRTLILACHEAVENWHITEWHITEPINK,
Forte Forte sequin-embellished coat Neutrals 14949MYCOAT,
Forte Forte button trousers Red 14951MYPANTS,
Stuart Weitzman Vinnie 50 slingback pumps Neutrals VINNIE50SLINGBACKMHG,
Moncler patch-pocket jacket Black L10938G0002689BDU,
Valentino Garavani floral-appliqué puffed-sleeve shirt White BAB8G15A6,
ASPESI single-breasted pocket blazer Blue S6NN5387961,
MC2 Saint Barth charm-detail swimsuit Blue CRC0001,
Gold Hawk lace-trim camisole top Green GH4168E13,
Gold Hawk lace-trim camisole top Black GH4875,
Max Mara belted button-down maxi dress White 2616221029600,
'S Max Mara drawstring trousers Yellow 2619131073600,
Kuboraum square-frame glasses Brown K26,
Common Projects panelled suede-trim sneakers Neutrals 62241302,
Laminar hooded zip-up jacket Black GI00150DL128539300,
Nine In The Morning Fiamma wide-leg trousers Neutrals FMM15FIAMMA,
'S Max Mara belt-loops pants Blue 2619781023600,
Nine In The Morning Fiamma wide-leg trousers Green FMM15FIAMMA,
'S Max Mara zip-up sweatshirt Yellow 2619921013600,
Junya Watanabe x CamperLab Tossu sneakers Black A500005033,
Le Silla Rose thong sandals Brown 1219F020MTPP,
Sportmax Zero flared-leg jeans Blue 2612181012600,
sacai pleated striped midi skirt Black 2608376,
sacai ribbed-knit tank top Black 2608400,
Max Mara Cali belted wide-leg trousers Green 2616111012600,
'S Max Mara Onorata straight trousers Green SMMONORATA003LINFA,
Max Mara floral-print strapless dress Pink MSEDOMINIO003CIPRIA,
ETRO pleated cuffed trousers Neutrals WREA008399TJ447,
Peserico Prince of Wales-check trousers Neutrals P04072Z02599,
PT Torino welt-pocket trousers Black CDVSANZ00STDSD850990,
Tagliatore peak-lapel double-breasted blazer Blue JPARIGI10BSV440062,
Tagliatore pinstriped double-breasted suit Neutrals TPARIGI10BAD520101,
Tagliatore fringed guru-collar jacket White JAQUELINE160074X1192,
LIU JO long dress with ruching Neutrals CA6278TS246P9640,
LIU JO long pleated lurex dress Pink CA6382JS006,
Alexander McQueen mock-neck sleeveless maxi dress Black 854343QEAHL,
EMME Sauna drawstring trousers White SAUNA,
EMME embellished T-shirt White TESSILE,
EMME Ape T-shirt White APE,
Baum Und Pferdgarten Janet striped tie-sleeve top White 24819JANET,
Baum Und Pferdgarten July number-print striped T-shirt Orange 24778JULY,
Baum Und Pferdgarten Sikita ruffled mini skirt Pink 24730SIKITA,
ISABEL MARANT sweatshirt Mylan Black SW0177FAC3M03O,
ISABEL MARANT logo-detail leather card holder Black MP0059FBC3X01O,
ISABEL MARANT single beaded charm earring Silver BL0302FAD2B09B,
ISABEL MARANT Dalby leather ankle boots Brown BO0188FAC1A19S,
Herno hooded coat Neutrals GC000570D12483Z,
ETRO paisley-print belted shirt dress Orange WRHA0521AKI49,
Fisico ring-tie bikini Black FR42FS17M0,
ETRO paisley-pattern ruffled maxi dress Blue WRHA063199SAEI4,
Fisico knotted bikini Pink FR32FS15M0,
Fisico Azalea sheer tie-fastening dress Pink CK82L0,
Valentino Garavani ballerinas VLogo Signature in nappa 05mm Black WS0QA8URN,
Thom Browne button down pocket shirt White FLR005OF1004,
CUBA LAB x SanPa 'Habanera Cuoieria' woven bucket bag Neutrals 8051944590074,
CUBA LAB raffia tote bag Neutrals 8051944590289PINKBRICK,
Chloé mini Summer Banana tote bag Neutrals CH26UP782P08,
Max Mara pleat trousers Neutrals 2616131092600,
sacai floral-print midi dress White 2608524,
'S Max Mara logo-patch straight-leg trousers Pink 261913E12,
Moncler bouclé zip-up sweater Neutrals L10938G0002689BDU,
P.A.R.O.S.H. tie-waist jumpsuit Black PANTY26D790179,
sacai puff-sleeve sweater Black 2608346,
Max Mara belted shawl-lapel evening suit Pink MSEBIACCO013CIPRIA,
Max Mara Bchriga cut-out ring-detail dress Red 2616621019600,
Max Mara Cali lace shirt White 6111016206031,
Max Mara asymmetric draped midi dress Red 2616621029600,
'S Max Mara Onorata straight trousers Neutrals SMMONORATA001BIANCO,
ETRO double-breasted jacquard jacket Neutrals WRCA0108AU153,
ETRO paisley-print cropped top Black WRJA018699TJS95,
Peserico button shirt Blue S0649102600,
LOIS JEANS label denim White 25766491,
Tagliatore pinstriped double-breasted suits Blue TLORELEY19BEI120007B3147,
PT Torino cuffed trousers Blue CDVSANZ00STDSD850360,
PT Torino pleated-design trousers Brown CDVSLLZ00STDZI560180,
PT Torino pleated shorts Brown CDBSSMZ00STDSP140170,
Tagliatore double-breasted peak-lapel blazer Neutrals JPARIGI10BSV440062,
PT Torino button-detail trousers Neutrals CDVSANZ00ST,
PT Torino textured trousers Brown CDVSEAZ00STDSP140170,
Stuart Weitzman Vinnie slingback suede pumps Neutrals VINNIE85DRSAYSLINGBACK,
LEMAIRE Glove slingback pumps 80mm heel in leather Brown FO0256LL0199,
EMME floral-print blouse White GIURATO,
Marella Tenente crochet fringed knitted gilet White TENENTE,
V°73 Keira logo clutch bag Yellow 73BE9D1529KEIRAVANIGLIA,
V°73 Keira zip-up clutch bag Neutrals 73BE9D1529KEIRAOFFWHITE,
ISABEL MARANT Bekett suede wedge sneakers Neutrals BK0010FAC1E02S,
Valentino Garavani small soft Leather shopping bag Black WB0T83WLA,
UGG leopard-print ankle boots Neutrals UGSCLUMSNAT1134523,
Yuzefi Mochi knot-detail tote bag Neutrals YUZRS26HBMO,
Celine Pre-Owned 2000-2025 Smooth Calfskin Cuir Triomphe Chain shoulder bag Black BYBYFR67U4TPU1JC,
Jacquemus La Robe Berlingot mini dress Blue DRW00759AW00648,
sacai striped floral-print blouse Black 2608526,
sacai floral-embroidered T-shirt Black 2608533,
Scarosso Luisa loafers Brown LUISALOAFBROSUED,
Scarosso Luisa tassel-detail loafers Green LUISALOAFJGRSUED,
Ralph Lauren RRL long-sleeve henley top Neutrals 282P17012,
Ralph Lauren RRL laced V-neck midi dress Blue 282P17008,
sacai hooded zip-up jacket Black 2608496,
Ray-Ban x Asap Rocky rectangle frame glasses Black 0RX3927V,
Ray-Ban mottled oval-frame sunglasses Grey RB2223144832,
Ray-Ban Idan Bio-Based sunglasses Silver RB378200380,
Ray-Ban round-frame sunglasses Green 0RX7046,
Ray-Ban x Asap Rocky rectangle rimless glasses Grey 0RX3928V,
Gucci Eyewear square Horsebit-detail sunglasses Brown GG2052S002,
Scarosso Luisa tassel-detail loafers Neutrals LUISALOAFSANSUED,
Ralph Lauren RRL space-dye pointelle-knit cardigan Neutrals 282P17000,
Ralph Lauren RRL floral-print maxi dress White 282P17007,
Ralph Lauren RRL eyelet lace-trim blouse Neutrals 282P16979,
Ralph Lauren RRL pocket sleeveless jumpsuit Neutrals 282P16991,
Ralph Lauren RRL pinstripe-pattern halterneck top Blue 282P17002,
Ralph Lauren RRL long sleeve polo top Black 282P17012,
Ralph Lauren RRL patterned check shirt Neutrals 282P17024,
Ralph Lauren RRL floral-embroidered smocked blouse White 282P17004,
IRO Naomy ruffled cropped cotton top Blue WM16NAOMY,
Chie Mihara Mira perforated T-bar pumps Neutrals MIRA48,
Crime London glitter-embellishment sneakers White 29152PP8,
Goshwara London blue topaz and diamond necklace Gold JP0329LBTY,
Roberto Demeglio Dama diamond bracelet Black 9D4PN1DBS,
JADA LOVELESS Classic Roll clutch bag Red JL504AJROUGE,
JADA LOVELESS Metropolitan tote bag Blue JL635AJCOBALTLAPIS,
Gianvito Rossi Malé self-tie sandals Purple G3270295RICAYE,
Roberto Demeglio Sfera diamond bracelet Black 9S4GCN1DBWS,
Roberto Demeglio diamond bezel bracelet Gold BTB65DBOG6,
Goshwara 3-Tier oval blue topaz and lapis earrings Gold JE0631BTLPY,
Goshwara blue topaz diamond ring Gold JR0140BTY,
Just Cavalli Vintage 1990s roll-neck animals-print sweater Brown W241212533,
Max Mara Skipper tie-detail jacket Blue 6041016406067,
Max Mara Sumero belted trousers Neutrals 6131036206028,
Max Mara Cena strapless lace dress White 6221016206002,
Studio Amelia Helix multi-strap sandals Black F860CFS,
Issey Miyake ribbed midi dress Purple IM56FH651,
Issey Miyake pleated sleeveless mini dress Black IM56FH650,
Ralph Lauren RRL patterned button cardigan Neutrals 282P17001,
Ralph Lauren RRL short-sleeved jumpsuit Blue 282P16993,
Bibi Lou Nolia sandals Black 630Z21VK,
Bibi Lou Ali pumps Black 665Z10VK,
Bibi Lou patent-leather sandals Black 595Z21VK,
Bibi Lou square-toe sandals Red 630Z21VK,
Chie Mihara tassel-detail mules Silver VINCCI48,
IRO Suny belted-waist notch-lapel jacket Green WM07SUNY,
IRO Natacha chest-pocket button-down cotton shirt Blue WM18NATACHA,
Sportmax Cocco chest-pocket buttoned shirt Pink 2612191022600,
Bond-eye crinkle-texture V-neck swimsuit Green 693M,
Bond-eye U-detail bikini Blue 714R048R,
Au Départ N.28 printed shopping tote bag Black BWTT007,
Co collared cashmere sweater Neutrals 8328CMRPS26,
Co one-shoulder midi dress Black 4189SJVIPS26,
Au Départ printed leather card holder Brown SCAH001,
LOIS JEANS Asha jeans Blue 34697951,
A.P.C. crew-neck T-shirt White COHMBM26384,
PT Torino Daisy trousers Black CDVSDAZ00STDVD05,
Co V-neck cashmere sweater Brown 7931CMRCORE,
Co pleated top Black 2156OPNPS26,
Lancel Mistral Rollable tote bag Purple A139961HTU,
Lancel medium Mistral Rollable zip tote bag Green A13995YYTU,
Co V-neck midi dress Black 4507VWCSPS26,
Lancel Mistral Rollable tote bag Neutrals A13996YYTU,
Saint Laurent striped shirt Neutrals 857276Y2N58,
Santoro belted suede jacket Green 50018D,
Lancel medium Mistral Rollable jacquard tote bag Neutrals A13997KZTU,
Santoro suede jacket Blue 50017D,
Santoro buttoned leather jacket Brown 50015D,
Santoro buttoned leather jacket Black 50035D,
Au Départ printed leather card holder Black SCAH001,
Co poplin midi dress White 4582LCSPCORE,
Co poplin long-sleeve shirt White 1236ACPPS26,
Lancel large Zip tote bag Neutrals A1399650TU,
Emporio Armani tie-fastening shirt dress White EW000817AF20252,
Emporio Armani logo-detail shirt Blue EW003325TE14012,
Emporio Armani macramé buttoned cardigan White EW002977AF22471U1058,
Emporio Armani camouflage-print jacket Grey EW004329TE20059,
Emporio Armani pointelle-knit top Neutrals EW004676AF25815F1054,
MC2 Saint Barth Meave striped shorts Pink MEA002,
MC2 Saint Barth frayed logo-print tote bag Pink VANI00100135L,
MC2 Saint Barth striped cotton shirt Blue CYS0001,
Givenchy Pre-Owned 2014 mini Pandora animal-print box bag Brown NAPBKGBBA083220W,
Gran Sasso openwork striped sweater Black 5722123702597,
Retrofete embroidered crystal-embellished jeans Blue RHL261234814ZERM,
Lorena Antoniazzi star-charm wide-leg trousers Green P2646PA02F40490616,
Fiorucci heart-motif mesh-panelled leggings Black W26SSBPA026LY04BK01,
Gran Sasso glitter-effect striped top Blue 5722023702597,
Coccinelle C-Me grained-leather wallet Black E2U4G113201,
PT Torino Anita bow-detail halterneck top Neutrals 6STP100STDIC23,
THE ANDAMANE draped ruched mini skirt Black T190309ATNP263999,
D.Exterior floral-applique T-shirt Neutrals 623188ARGI,
Ermanno Scervino pleated midi skirt Pink D482O368EWF,
Carel Paris braided strap flats Silver ARIANA,
Sebago striped button-fastening shirt Pink 751271W,
Filippa K gathered-back bikini top Brown 32239,
D.Exterior sheer silk cape Brown 626936MOCH,
D.Exterior pleated-waistband wide-leg trousers Black 629022NERO,
Carel Paris buckle strap ballet flats Neutrals COSTA2620,
Antonelli Norris ruffled midi dress Pink Q6927794573,
ICON DENIM Jill straight-leg jeans Blue JILLID8800,
Marella pressed-crease belt-loop trousers Grey 2615131081200320003,
Gran Sasso V-neck long-sleeve blouse Brown 6123250000167,
Burberry Check wool tailored shorts White 8120570,
D.Exterior wide-leg palazzo pants Pink 620105CONC,
Fiorucci striped cotton shirt Red W26SSTSI007CO02RD01,
D.Exterior beige top Neutrals 626445CONC,
Lorena Antoniazzi striped drawstring-waist trousers Green P2657PA31A52180616,
THELATEST pinstripe-pattern elasticated-cuff trousers White TLW03126T0166ABTP,
Gran Sasso striped short-sleeve T-shirt Blue 4321014786594,
Gran Sasso striped metallic-trim top Blue 4321114786594,
Eleh drawstring jacket Brown SS260207MORO,
Carven wide-leg trousers Brown 6261K21060N809,
Federica Tosi pleated trousers Brown 40804407,
Lorena Antoniazzi striped drawstring trousers White P2655PA31A51791080,
Off-White Jitney 1.4 tote bag Neutrals OWNP062S26LEA0016E6E,
Guest In Residence Compass Jane pointelle-knit cardigan Neutrals W40110PL,
Ermanno Scervino lace shirt Neutrals D482K343APEWF20304,
Rick Owens graphic-print drawstring boxers Neutrals RP01F6351KP1,
Eleh tailored trousers Blue SS260170BLUNAVY,
THE ANDAMANE Wendela button-up trousers set Purple T196469BTNC193185,
Marella fringe-hem jeans Blue 2615181041200507003,
Givenchy pleated tailored trousers Neutrals BW519E164D,
IRO Soledad sleeveless notched-lapels jacket Grey WM07SOLEDAD,
Bibi Lou square-toe sandals Neutrals 630Z21VK,
Bibi Lou Ali pumps Neutrals 665Z10VK,
Bibi Lou Lint sandals Red 595Z21VK,
MAX&Co. pleated sleeveless midi dress Purple WCV240618,
Vintage 2019 floral-print midi dress Black U1300108,
PUCCI Pre-Owned printed mini dress White WCV241016,
Versace Pre-Owned ruched-detail mini dress Red CVB21461,
PINKO button blazer Brown 106597A34I,
Amina Muaddi Holli slingback pumps Black 16S365909HOL,
PT Torino knee leght shorts Neutrals CDBSOAZ00STDDX18,
Emporio Armani striped scarf Grey EW004578AF25414F4047,
NISSA appliquéd sequinned tulle maxi dress Black RS16382,
Aquazzura Copacabana strap sandals Brown CPAMIDS0CWKTOB,
Calvin Klein floral-print cap-sleeve top Green LV044F148GPEZ,
Carel Paris Ariana braided leather ballet flats Neutrals ARIANAT21,
rag & bone Miramar cottn jeans Blue RC7025H7MTEARIA,
Off-White striped pocket shirt Neutrals 2GE02OS26FAB001W142,
Calvin Klein ribbed-knit V-neck tank top White LV044F213GYAS,
Gran Sasso argyle-knit short-sleeve polo top Black 5721023010598,
Fiorucci striped cotton shirt dress Red W26SSDRI006CO02RD01,
Agnona pocket belted trousers White T71105YU2130N01,
Moncler Grenoble logo-print T-shirt Red 988C0001089AZ9453,
Thom Browne striped polo shirt White FKP132AY5502100,
rag & bone seam-detail T-shirt Blue RC3726SSMJRARIA,
sacai V-neck blouse Black 2608487,
D.Exterior sleeveless vest Black 626442,
Blumarine ruffled net blouse Black P644C234A,
Blumarine butterfly net blouse Black P644C262A,
Christian Louboutin Pyra Clou floral-print studded sandals Pink 1260530J646,
L'Agence drawstring-fastening palazzo pants Brown 80132CXB2,
LouLou de Saison Dakota sweater Neutrals DAKOTA01,
Federica Tosi ribbed-knit racerback maxi dress Green 4235548288,
Coperni logo-detail short-sleeve mini dress Black COPJS210F5012,
Antonelli V-neck top Grey N5913Q794576,
Federica Tosi cape-sleeve open-back maxi dress Brown 4410041258,
Gran Sasso V-neck top Blue 6121550069598,
D.Exterior shawl-collar jacket Black 629012,
sacai striped pleated T-shirt Blue SCW352,
Furla mini 1927 chain-strap cross-body bag Pink BAFKACOARE000,
ICON DENIM Rory acid-wash jeans Blue RORYID8798,
ICON DENIM Kendall wide-leg jeans Blue KENDALLID8834,
sacai stripe-pattern skirt Blue SCW341,
Federica Tosi backless button jacket Neutrals 41356406,
Off-White striped shorts White 2CB05JS26FAB001W142,
Federica Tosi ribbed V-neck midi dress Purple 42305451,
AMIRI women´s Ma Hardware cardigan Neutrals AWTOKN1015,
LOIS JEANS denim shorts Blue 21847901,
Gran Sasso fine-knit cardigan top Blue 43280,
Gran Sasso V-neck wool top Blue 4328114731594,
Ruslan Baginskiy frayed hat cap Blue KPC075CJNSPRVJNSRB,
Giuseppe Di Morabito strapless mini dress Black 06PSDR704,
Gran Sasso lurex-detail striped sweater Neutrals 5722023702005,
D.Exterior linen turn-up trousers Neutrals 627788ARGI,
Gran Sasso striped open-knit top Blue 1022118421598,
Maison Labiche crew-neck T-shirt Blue ZWPOITOUCOEURVULTRAMARINE,
Rick Owens Radiance Bather ruched swimsuit Orange RP01F6089NS,
Aquazzura round-toe loafers Brown GNNFLAM1PYPMLT,
Veronica Beard arch resin belt Brown A2603HLV05D015,
AGOLDE striped shirt Neutrals A74481790,
Vivienne Westwood plaid buttoned blazer Neutrals 1401007SW01EGB208,
Thom Krom V-neck midi dress Black WD6103,
Thom Krom round-neck T-shirt Black WTS6120311,
Fabiana Filippi embellished trousers Neutrals PAD276F336M121,
Brunello Cucinelli buttoned tailored trousers Red MH827HZ589C9093,
Brunello Cucinelli zip-up hoodie Red MH827HZ506C9093,
Thom Krom crew-neck T-shirt Neutrals WTS6120341,
Thom Krom round-neck top Neutrals WTS6170341,
Antonelli sequin-embellished belted midi dress Brown Q66494115242,
TWINSET embroidered blazer with belt Blue 261TE2020,
Tagliatore Parigi buttoned blazer Brown JPARIGI10B340311,
Thom Krom V-neck T-shirt Neutrals WTS6220341,
TWINSET floral-DETAIL trousers Blue 261TE2023,
Antonelli cotton midi dress Neutrals Q6649,
LouLou de Saison Iraka maxi dress Black IKARA,
F.P. Journe 2008 Octa Automatique Lune 40mm watch White OCTAAUTOMATIQUELUNEREFAL,
F.P. Journe 2023 unworn Chronomètre Optimum 40mm watch Grey REFCO,
Valentino Garavani Rockstud slide sandals in suede 05mm Brown WS0C49CVB,
Valentino Garavani Rockstud suede belt Brown 9W2T0SX7HUH,
Valentino Garavani VLogo Signature zip wallet in grainy calfskin Black WP0BB3SNP,
Valentino Garavani VLogo Signature crystal-embellished belt Black WT0SX4RTV,
Valentino Garavani Locò small shoulder bag in calfskin Black WB0K53DUM,
Nike Free Metcon 6 logo-detail sneakers Blue FJ7126,
ENTIRE STUDIOS jersey T-shirt Neutrals ESSS26TT030120053,
ENTIRE STUDIOS Barren cargo trousers Brown ESSS26PA050120015,
Brunello Cucinelli pleated midi skirt Neutrals M0F79G3951C9266,
Prada cashmere crew-neck sweater Blue P24B3ASOOO19IK,
Nanushka halterneck cut-out detail midi dress Black NW26PSDR08399,
Lauren Ralph Lauren large Cameryn tote bag White 431960183003,
Lauren Ralph Lauren logo-keeper leather belt White 412968763010,
Lauren Ralph Lauren cable-knit logo jumper Blue 200P07025001,
Circolo 1901 single-breasted jacket Neutrals FD3859,
On x Kith K-Tech 1 "Black" sneakers Black 3WG10701043,
On K-Tech 1 "Tofu/Moss Green" sneakers White 3WG10705561,
On x Kith K-Tech 1 "Tofu" sneakers White 3WG10705560,
PINKO printed shoulder bag White 106673A3B6,
Patrizia Pepe logo-plaque shoulder bag Black 8B0228L001K118,
Les Girls Les Boys elasticated-waistband track pants Green ST110J0001,
DKNY Bryant Ave tote bag Neutrals R42AYE20,
PS Paul Smith block-stripe knit wool cardigan Neutrals W2R801NV31413,
AGOLDE cotton jeans Blue A2601601,
Valentino Garavani VLogo Signature lace slingback pumps 80mm Black WS0R01MMC,
Valentino Garavani Rockstud calfskin thong sandal 05mm Black WS0QD3MRI,
Valentino Garavani VLogo Signature split-leather boots 40mm Brown SS0QA3EFG,
F.P. Journe 2023 Chronomètre Souverain 'Havana' 40mm watch Brown CHRONOMTRESOUVERAINREFCS,
F.P. Journe 2024 Linesport Automatique Réserve 44mm watch Black AUTOMATIQUERSERVEREFAR2,
Valentino Garavani Coeur Royal slingback pumps Black WS0PR9DMD,
Valentino Garavani Rockstud slide sandals in suede 60mm Brown WS0C47CVB,
Barbara Bologna ruffled lace-texture asymmetric skirt Neutrals PIZZO10,
Saint Laurent small Le 5 À 7 shoulder bag Neutrals 823812GAAEZ,
Brunello Cucinelli buttoned jacket Neutrals ML9967674C9325,
Herno drawstring-hem T-shirt White JG000320D52000,
Miu Miu denim backpack Blue 5BZ042VOOMACRR,
Lauren Ralph Lauren hooded button-up coat Blue 297967121005,
Lauren Ralph Lauren small Cameryn crossbody bag Green 431982184006,
Officine Creative Lexikon ankle boots Black LEXIKON555,
Officine Creative Lexikon ankle boots Neutrals LEXIKON555,
MARREA large Marrea tote bag Neutrals MRR18401004,
FARM Rio floral-embroidered midi linen dress Neutrals 348687,
Barena Amado Viano pleated bermudas Green PAD55612736,
HOKA Mafate Speed 4 Lite lace-up sneakers Green 1168450,
Lacoste contrast-trim round-neck logo-detail cotton T-shirt Blue TF5289,
Mykita Solea round-frame glasses Blue SOLEA,
LINDA BAUMANN fur-trim suede loafers Brown 658525233BRW,
Lacoste elasticated-waistband track pants Blue XH1661,
Betty Barclay belt-loops denim jeans Blue 62171980,
'S Max Mara crew-neck T-shirt White 2529366041600,
Del Maar paisley bikini bottoms Neutrals DMF286BOTTOM,
Anna October Maia floral-embroidered corset White PF2432,
Lacoste small Daily City wallet Black NF4764DZ,
Liviana Conti Kendra blouse Brown F6SS19,
On perforated baseball cap Grey 2UF10330122,
Proenza Schouler White Label Evelyn plaid V-neck maxi dress Green WL2623691SY015,
Betty Barclay short zipper blazer Black 42722738,
Stuart Weitzman Vinnie Wedge mules Brown SN848Q1R,
LINDA BAUMANN lace-up loafers Black 658525232BLK,
Liviana Conti V-neck floral print dress Black F6SG46,
Kenzo embroidered logo knitted throw Brown 1020814,
Caractère carrot pants Blue P145A0,
Aesop Istros room spray Brown B100FR17EU,
The Mannei Terron pleated shorts Blue TERRONSHORTS,
LINDA BAUMANN buckle loafers Red 658525217BRD,
Paul Smith striped bucket hat Purple W1A723AU004,
Lacoste Day in L adjustable-strap logo shoulder bag Black NF5235DJ,
Alexander McQueen lace-up sneakers White 862794WIAJ8,
FARM Rio Cashew and Birds swimwear Red 344779,
FARM Rio Delhi floral sleeveless maxi dress Blue 344231,
Nº21 boat neck top Blue 26EN2S0A01990516394,
Karl Lagerfeld one-shoulder swimsuit Black B1W46029999,
Nº21 crew-neck T-shirt White F0414157,
LINDA BAUMANN lace-up shoes Black 658525227BLK,
FARM Rio maxi Boho Delhi floral dress Pink 349157,
MARCCAIN Warangal rope belt shorts Neutrals AC8304W70,
Betty Barclay embellished trim knitwear Brown 47181178,
Alexander McQueen patch-pocket midi skirt Blue 872015QJAAC,
Betty Barclay buttoned shirt White 86159555,
LINDA BAUMANN metal-trim loafers Black 658525228BLK,
Il Bisonte grained foldover wallet Brown SMW036PV0005,
LINDA BAUMANN lace-up shoes Black 658525226BLK,
Balenciaga small Rodeo shoulder bag Neutrals 7897792AB4G,
Betty Barclay turn-up trousers Black 63641053,
LINDA BAUMANN emblem faux-fur loafers Black 658525233BLK,
Carel Paris Banana multi strap sandals Black BANANAVERNISNOIR,
Balenciaga reversible leather jacket Black 856381TRS25,
Lacoste drawstring track pants Brown XH1661,
Courrèges sleeveless pocket dress Black 126CRO763PL0170,
AAPE BY *A BATHING APE® embroidered logo track shorts Grey AAPSPW6980XAK,
AAPE BY *A BATHING APE® Moonface patch jeans Blue AAPJNW6976XXK,
AAPE BY *A BATHING APE® Moonface-patch jeans Pink AAPJNW6976XAK,
AAPE BY *A BATHING APE® logo-embroidered track pants Neutrals AAPPTW6977XXK,
AAPE BY *A BATHING APE® Moonface camo-print T-shirt Blue AAPTNW1323XXK,
AAPE BY *A BATHING APE® logo-embroidered shorts Black AAPSPW6980XXK,
AAPE BY *A BATHING APE® Moonface embroidered crop top Neutrals AAPTKW1304XXK,
AAPE BY *A BATHING APE® Moonface floral-pattern textured shorts Blue AAPSPW6979XXK,
AAPE BY *A BATHING APE® Moonface patterned shorts Black AAPSPW6974XXK,
AAPE BY *A BATHING APE® elasticated-waistband shorts Orange AAPSPW6979XXK,
LINDA BAUMANN metal-embellished loafers Red 658525202BRD,
adidas Equipment Evo SL sneakers Brown KJ8840,
LINDA BAUMANN metal-embellished leather loafers Black 658525201BLK,
Alaïa 9mm square-toe knee-high calfskin boots Brown AA3O2005I052,
Carel Paris Kina buckle-strap pumps Blue KINAVERNISBLUEMARINE,
Proenza Schouler gold-tone crinkle soft-track lace-up sneakers Gold SH261117X018FR,
Alex Perry embellished mini skirt White S0165PF24,
Melissa Odabash ring-detail triangle bikini top Purple MOCANCUN,
MARCCAIN belted mandarin-collar gilet Neutrals AC3704W70,
Paul Smith Clareen slingback pumps Black W1SCLR01ULEA,
Betty Barclay slim-fit trousers Blue 68182518,
The Mannei lace shorts Grey RS26021,
Coccinelle flap cross body bag Blue E1MF6150601,
Betty Barclay hooded coat Neutrals 79301511,
Patrizia Pepe Fly leather clutch bag Blue 8B0229L061,
Betty Barclay Perfect Body trousers Brown 61491742,
Paul Smith Painted Stripe shirt Neutrals W1R351BV03018,
LINDA BAUMANN black loafers Black 658525211BLK,
Dorothee Schumacher cropped jacket Black 444702,
Barrie fringed stitching mini skirt Blue C85555,
SABLYN turtleneck ribbed cardigan Neutrals SABLE2407,
Lacoste Day in L Top Shoulder Bag Neutrals NF5235DJ,
Max Mara triangle-cup bikini top Neutrals 2516821369600,
GINORI 1735 floral porcelain tea saucer White 003RG00FPT401010150G00133000ONE,
Seafolly open-work trousers Black 55528PA,
Lacoste logo trousers White XH1661,
Moncler Pacey2 logo-embroidered sneakers Neutrals L109A4M00030M8008,
VICOLO blue trousers Blue DAB5208,
Max Mara textured sweater Neutrals 2611361078600,
Moncler logo-patch padded vest Black L10971A00008597X6,
Birkenstock Madrid buckked sandals Black 1006523,
LINDA BAUMANN lace-up oxford shoes Brown 658525232BRW,
Reebok racerback cutout tank top Blue AY0951,
LIU JO appliqué jacket White WA6262T367AP9255,
DSQUARED2 Dsquared2 logo one-piece swimsuit Grey D6BGC5030ISA01,
THE ANDAMANE pocket shirt Neutrals T190901BTNP246108,
MOTHER straight jeans Blue 10818259,
By Malene Birger Cymbaria pleated trousers Black 101829,
Paul Smith Camolin buckle sandals Red W1SCMN01ULEA,
Alexandra Golovanoff Mila fair isle-pattern cardigan Red CARDIGANMILA,
Coccinelle logo-detail shoulder bag Neutrals E1T95150201,
SABLYN turtleneck cropped sweater Brown SABLE2506,
MOTHER The Whole Lot Zip Twist Fray shorts White 4198544,
Betty Barclay wide-leg jeans Blue 62171980,
Lisa Yang short-sleeve T-shirt Neutrals 202147,
Stouls gathered leather top Orange LAYALEATHERCARAMEL,
The Row Nan messenger shoulder bag Brown W1812L614,
Ciele logo-patch ear-flap trapper hat Black U2CA0197BK002,
KNWLS rounded strap shoulder bag Grey SS24RAZR0MOG,
Blazé Milano Anabas pinstripe shirt Blue SHBSH08ECATAW01,
Liviana Conti woven kitten-heel sandals Black A6SC55,
Paul Smith fish-embroidered kaftan White W1A334FU396,
VICOLO seam-details jeans Blue DAB5244,
PETER KAISER pointed pumps Black 97234444,
AAPE BY *A BATHING APE® graphic-print T-shirt Blue AAPTNW1334XXK,
AAPE BY *A BATHING APE® Moonface-patterned T-shirt Blue AAPTNW1322XXK,
AAPE BY *A BATHING APE® embroidered track pants Black AAPPTW6977XXK,
AAPE BY *A BATHING APE® Moonface logo-tape track pants Grey AAPPTW6978XAK,
AAPE BY *A BATHING APE® logo-patch track pants Black AAPPTW6978XXK,
AAPE BY *A BATHING APE® graphic mini dress Black AAPDSW8451XXK,
AAPE BY *A BATHING APE® graphic T-shirt Black AAPTEW1331XXK,
AAPE BY *A BATHING APE® tie-dye graphic shirt White AAPSTW8447XXK,
AAPE BY *A BATHING APE® bunny graphic T-shirt Grey AAPTEW1317XAK,
Hunza G Sandy halterneck bikini (set of two) Blue SANDYBIKINI,
Hunza G oversized seersucker shirt Blue SEERSUCKEROVERSIZED,
Hunza G elasticated-waistband shorts Blue SEERSUCKERRUNNERSH,
Hunza G Shorty bikini bottoms Black SHORTYBOTTOM,
Hunza G seersucker oversized shirt White SEERSUCKEROVERSIZED,
Hunza G Eloise ruffled swimsuit Black ELOISESWIM,
Hunza G Patricia crinkle-effect bikini Blue PATRICIABIKINI,
Hunza G Julia hoop-detail bikini Red JULIABIKINIGOLDHO,
Hunza G Patricia crinkle-effect bikini Green PATRICIABIKINI,
Hunza G Toni ring-detail swimsuit Green TONISWIM,
Hunza G Julia hoop-detail bikini Blue JULIABIKINIGOLDHO,
Hunza G Iris crinkle-effect bikini Green IRISBIKINI,
TOM FORD polka-dot velvet blazer Black GI3116FAP260,
TOM FORD logo-waistband trousers Neutrals PAW683FAX1720,
TOM FORD logo-waistband silk-satin pyjamas shorts Neutrals SH0080FAX1720,
TOM FORD logo-waistband silk shorts Black SH0080FAX1720,
TOM FORD logo-embroidery pajama shorts Black SH0089FAX1824,
TOM FORD polka-dot waistcoat Black WA0049FAP260,
Fusalp Ranger logo-patch bucket hat Green J37055060,
Fusalp Anim cotton baseball cap Green J37041018,
extreme cashmere Nº280 Bi crew-neck cardigan Black 280,
extreme cashmere Nº474 Super Little buttoned cardigan Black 474,
Balenciaga Pre-Owned 2010-2026 Grained Calfskin Logo Ville Day XS crossbody bag Black R2A0SFO549LYWJO7,
Fendi Pre-Owned 2000-2010 Zucchino Canvas tote bag Brown BL8DQ95S14ZJLWU3,
extreme cashmere Nº479 Runaway track pants Grey 479,
Gucci Pre-Owned 2000-2015 GG Satin Abbey D Ring tote bag Brown 9ZM5E2GF4LZN3GHT,
PINKO single-breasted blazer Neutrals 106526A374,
ETRO medium leather Doc shoulder bag White WP1B0031AP398,
Maison Michel Kiki emblem ribbon hat Neutrals 1041170001,
Maison Michel Virginie ribbon hat Neutrals 1001299001,
Maison Michel Natasha fringed hat Blue 2668001001,
extreme cashmere Nº416 Noor T-shirt Blue 41600118TU05NAVY,
extreme cashmere Nº473 Lizzy long-sleeves sweater Black 473,
Agnona pleated shorts Neutrals T81103XU3049,
Avant Toi metallic-finish silk sweater Neutrals 226SD1701PSFVLH,
Nuur cut-out ribbed-knit sweater Black 261FXA31201,
Dolce & Gabbana Majolica-print silk and twill tank top White FXT06TJBSP8,
Dolce & Gabbana 50x50 Majolica-print silk twill scarf Red FN093RGDAOY,
Dolce & Gabbana 70x70 Majolica-print silk twill scarf Red FN092RGDDU8,
Dolce & Gabbana Majolica-print jersey t-shirt White F8V81TGDDT7,
Dolce & Gabbana majolica-print silk top White F7BQ8TGDDRE,
Dolce & Gabbana Majolica-print silk twill bustier top White F7BB0TGDDRE,
Dolce & Gabbana Majolica-print charmeuse top White F7BA8TGDDRJ,
Dolce & Gabbana Majolica-print poplin top White F755RTGDDRL,
Dolce & Gabbana Majolica-print poplin top White F72G7TGDDRH,
Dolce & Gabbana majolica-print twill dress Red F6TVLTGDDRE,
Dolce & Gabbana Majolica-print long poplin dress White F6TTHTGDDRL,
Dolce & Gabbana Majolica-print organzine Long Dress Orange F6DAOTFS8DS,
Dolce & Gabbana Majolica-print charmeuse short dress White F63G9TGDDRJ,
Dolce & Gabbana Majolica-print twill short kimono dress White F617NTGDDRE,
Dolce & Gabbana sequin dress Red F615NZGDDS4,
Dolce & Gabbana Majolica-print long kaftan dress White F615BTGDDRH,
Dolce & Gabbana Majolica-print organzine long dress Orange F614VTFS8DR,
Dolce & Gabbana Majolica-print poplin dress White F614TTGDDRD,
Dolce & Gabbana flared dress in majolica-print poplin White F614RTGDDRD,
Dolce & Gabbana majolica-print poplin Camicia White F5T66TGDDRD,
Dolce & Gabbana Majolica-prints short-sleeved top White F5G67TGDDRE,
Dolce & Gabbana Majolica-print poplin short skirt White F4CB1TGDDRL,
Dolce & Gabbana miniskirt in Majolica-print mat White F4C7ETGDDRC,
Dolce & Gabbana single-breasted tweed jacket with jewel buttons Neutrals F27JAZHUMW9,
Dolce & Gabbana beachwear slides in rubber Orange CW2215AN99481166,
Dolce & Gabbana 3.5 card holder in majolica-print calfskin Orange BI0330AO026,
AAPE BY *A BATHING APE® bear graphic sweat mini dress Pink AAPDSW8451XAK,
AAPE BY *A BATHING APE® logo leggings Purple AAPLIW5173XAK,
AAPE BY *A BATHING APE® logo-print T-shirt Black AAPDSW8450XXK,
AAPE BY *A BATHING APE® relaxed tie-dye shirt Purple AAPSTW8447XAK,
AAPE BY *A BATHING APE® Moonface mesh-panelled T-shirt mini dress Blue AAPDSW8450XXK,
On x Kith K-Tech 2 "Thorn Ganache" sneakers Grey 3WG11024969,
Hunza G Phoebe crinkle-effect bikini Blue PHOEBEBIKINI,
Hunza G seersucker runner shorts White SEERSUCKERRUNNERSH,
Hunza G Camille crinkle-effect swimsuit Blue CAMILLESWIM,
Hunza G Nadine hoop-detail bikini Red NADINEBIKINIGOLDH,
Hunza G Julia hoop-detail bikini Green JULIABIKINIGOLDHO,
TOM FORD v-neck silk blouse Black TS2144FAX1720,
TOM FORD halterneck silk evening maxi dress Brown AB3711FAX1720,
TOM FORD logo-waistband silk pyjama bottoms Green SH0080FAX1720,
TOM FORD silk-satin pajamas shorts Brown SH0080FAX1720,
TOM FORD asymmetric draped evening maxi dress Green ABJ905FAX162,
TOM FORD polka-dot velvet trousers Black PAW708FAP260,
TOM FORD Grain De Poudre jacket Black GI3079FAX1667,
Gucci Pre-Owned 2016-2026 Mini Leather Horsebit 1955 Web crossbody bag Purple G56JISH5NX1G7PDJ,
extreme cashmere Nº478 Xtra Fun cardigan Blue 478,
extreme cashmere Nº478 Xtra Fun zip-up cardigan Brown 478,
Fendi Pre-Owned 2000-2010 Zucchino Canvas tote bag Brown XMD3PMQTOB99LAJH,
Bottega Veneta Pre-Owned 2010-2025 Small Nappa Intrecciato crossbody bag Pink RNPFRN0T3C3MY1LJ,
Gucci Pre-Owned 2000-2015 Embossed Leather Horsebit crossbody bag Black EV39ZKSIBFNUWKVF,
Gucci Pre-Owned 2000-2015 GG Canvas crossbody bag Brown D3Y4GWZDRY73MKZA,
extreme cashmere buttoned sweater Grey 473,
Louis Vuitton Pre-Owned 2003 Monogram Mini Lin Anne Sophie pouch Blue 40B0MGT4DBNVME7E,
PINKO midi cut-out pleated dress Brown 106828A2LD,
PINKO vest top with jewel stripes Grey 106214A31F,
Stuart Weitzman ankle-strap sandals Brown SN622,
Maison Michel Blanche frayed trim hat Neutrals 1004090001,
Maison Michel Austin logo-plaque hat Neutrals 1036041001,
Maison Michel Jason fringed appliqué hat Blue 2072067001,
Maison Michel André hat Neutrals 1003188001,
Maison Michel Pat ribbon visor Neutrals 1153009001,
CHANEL Pre-Owned 2009-2010 Small Quilted Nylon Coco Cocoon tote bag Green 0PHA09XW2QKZSC9I,
Louis Vuitton Pre-Owned 2011 Electric Epi Mirabeau PM satchel Black 0BRTTVTNKUHL9UOK,
Nuur open-knit sweater Blue 261FXA41006,
Saint Laurent elasticated long-sleeve midi dress Brown 861317Y6I66,
Dolce & Gabbana clip earrings with logo Gold WER6M4W1111,
Dolce & Gabbana clip earrings with logo Gold WER6M1W1111,
Dolce & Gabbana bracelet with logo Gold WBR6M1W1111,
Dolce & Gabbana Majolica-print one-piece swimsuit White O9A46JONO19,
Dolce & Gabbana Majolica-print one-piece swimsuit White O9A13JONO19,
Dolce & Gabbana majolica-print bikini Orange O8A27JONO19,
Dolce & Gabbana Majolica-print triangle bikini Orange O8A23JONO19,
Dolce & Gabbana Majolica-print terry beach towel Red O5A03JONN82,
Dolce & Gabbana satin bra Orange O1F45TONP15,
Dolce & Gabbana Majolica-print batiste sarong White O4A01JONO20,
Dolce & Gabbana satin briefs Red O2B23TONO13,
Dolce & Gabbana Majolica-print silk pullover White FXZ28TJBSP8,
Dolce & Gabbana Maiolica-print silk and twill cardigan White FXV10TJBSP8,
Dolce & Gabbana Majolica-print organzine trousers White FTDK8TFS8DS,
Dolce & Gabbana Majolica-print broderie anglaise lace shorts White FTDJZTGDDRB,
Dolce & Gabbana Majolica-print bermuda poplin shorts White FTDJVTGDDRD,
Dolce & Gabbana 5-pocket denim trousers White FTDJUDG8PY4,
Dolce & Gabbana Majolica-print silk trousers White FTDBNTGDDRE,
Dolce & Gabbana Majolica-print charmeuse leggings White FTDJ0TGDDRJ,
Dolce & Gabbana 6X100 Majolica-print silk twill scarf White FS215AGDDU9,
Dolce & Gabbana 90X90 Majolica-print silk twill scarf Red FN090RGDDU6,
Dolce & Gabbana Majolica-print jersey and twill mini dress White F8W65TGDDT0,
Dolce & Gabbana jersey Majolica-print t-shirt White F8W50TGDDT2,
Dolce & Gabbana jersey T-shirt with dg embroidery White F8W47ZGDDYF,
Dolce & Gabbana jersey T-shirt White F8W31ZGDDT3,
Dolce & Gabbana top in Majolica-print mat White F7U70TGDDRC,
Dolce & Gabbana Majolica-print organzine top White F7BS4TFS8DR,
Dolce & Gabbana Majolica-print poplin top Orange F7BB1TGDDRJS9000,
Dolce & Gabbana Majolica-print charmeuse fitted top White F7BM7TGDDRJ,
Dolce & Gabbana Majolica-print poplin bustier top White F78IUTGDDRL,
Dolce & Gabbana Majolica-print Charmeuse dress Red F6TVVTGDDRJ,
Dolce & Gabbana Majolica-print charmeuse dress with feather trim White F6ZW4ZGDDRJ,
Dolce & Gabbana Majolica-print mat dress White F6TZOTGDDRC,
Dolce & Gabbana Majolica-print long poplin dress White F6TTJTGDDRL,
Dolce & Gabbana Majolica-print poplin dress Orange F6TVKTGDDRL,
Dolce & Gabbana Majolica-print twill kaftan dress White F6TTFTGDDRE,
Dolce & Gabbana Majolica-print charmeuse dress White F6TSXTGDDRJ,
Dolce & Gabbana Abito dress White F6TSVTGDDRJ,
Dolce & Gabbana Majolica-print charmeuse dress White F6EAJTGDDRJ,
Dolce & Gabbana Majolica-print short dress Neutrals F68A8TGDDRC,
Dolce & Gabbana Majolica-print poplin short dress Orange F61ADTGDDRL,
Dolce & Gabbana Majolica-print long kaftan dress with feather trim Red F615FZGDDRE,
Dolce & Gabbana Majolica-print Habotai long dress White F615ETGDDRG,
Dolce & Gabbana Majolica-print chiffon short dress White F614ZTGDDRH,
Dolce & Gabbana short poplin dress in Majolica-print poplin White F614STGDDRD,
Dolce & Gabbana Majolica-print poplin shirt White F5U30TGDDRD,
Dolce & Gabbana long kaftan dress in majolica-print cotton White F614OTGDDRK,
Dolce & Gabbana Majolica-print organzine long dress Orange F611CTFS8DS,
Dolce & Gabbana poplin shirt White F5T78ZFUEFM,
Dolce & Gabbana Majolica-print silk shirt Red F5T52TGDDRE,
Dolce & Gabbana Majolica-print broderie anglaise lace shirt White F5T54TGDDRB,
Dolce & Gabbana Majolica-print poplin shirt Red F5S65TGDDRD,
Dolce & Gabbana Majolica-print silk Vanity shirt White F5Q03TGDDRE,
Dolce & Gabbana tweed skirt with jewel buttons White F4DE9ZHUMW9,
Dolce & Gabbana denim mini skirt White F4DDYDG8PE9,
Dolce & Gabbana long denim skirt White F4DDOZG8PE9,
Dolce & Gabbana tweed mini skirt with jewel buttons Orange F4DD3ZHUMW9,
Dolce & Gabbana Majolica-print poplin long skirt White F4CX0TGDDRL,
Dolce & Gabbana Majolica-print pleated skirt White F4CULTGDDRL,
Dolce & Gabbana Majolica-print silk robe-style coat Red F0AH2TGDDRE,
Dolce & Gabbana single-breasted tweed jacket with jewel buttons Orange F27JAZHUMW9,
Dolce & Gabbana Majolica-print rubber beachwear slides White CW2215AE854,
Dolce & Gabbana majolica-print brocade clog sandals Orange CV0081A9AA4,
Dolce & Gabbana mules in patent leather White CR2030A0727OPTICALWHITE,
Dolce & Gabbana Majolica-print brocade Keira mules with embroidery White CR1995AB826,
Dolce & Gabbana brocade mules with embroidery Orange CR1958A9AA2,
Dolce & Gabbana brocade sandals with embroidery Orange CR1959A9AA2,
Dolce & Gabbana Patent leather sandals with embroidery White CR1733AT848,
Dolce & Gabbana flat faux-fur slippers White CQ0721A0612,
Dolce & Gabbana Majolica-print brocade flat slippers Orange CQ0708A9AB2,
Dolce & Gabbana patent leather sandals with embroidery White CQ0601AT848,
Dolce & Gabbana flat slippers with Majolica embroidery Orange CQ0571AV804,
Dolce & Gabbana sequin ballet flats Red CB0284A0598,
Dolce & Gabbana majolica-print 3.5 calfskin card holder Red BI1261AO026,
Dolce & Gabbana raffia Coffa Capri bag Orange BB7915A0430,
Dolce & Gabbana mini My Sicily handbag in calfskin White BB7864B7321,
Dolce & Gabbana Coffa Capri bag with embroidery Neutrals BB7831A0842,
Dolce & Gabbana mini My Sicily handbag in calfskin Orange BB7864B7321,
Dolce & Gabbana Atene shopping bag in Majolica-print canvas Orange BB7826AN220,
Dolce & Gabbana medium My Sicily handbag in calfskin White BB7782B7321,
Dolce & Gabbana medium My Sicily handbag in plongé lux calfskin Orange BB7782B7321,
Dolce & Gabbana printed Kendra coffa bag Neutrals BB7695AV860,
Dolce & Gabbana mini Sicily handbag in calfskin Orange BB7116B1001,
Dolce & Gabbana Dolce Box handbag in raffia Orange BB5970A0403,
Dolce & Gabbana small Sicily handbag with Majolica embroidery Orange BB6003BW050,
Dolce & Gabbana mini Sicily handbag with bezels Red BB7116B0815,
CFCL buttoned sleeveless long vest Black CF011KL116GP00,
SAPIO metallic-finish pressed-crease jeans Silver N07TDENIM098,
SAPIO metallic-finish denim jacket Silver N4DENIM,
Chloé mini Marcie stitched tote bag Neutrals CH26SP927R35,
sacai belted split midi skirt Black 2608470,
sacai sleeveless pocket shirt Green 2608537,
Calvin Klein CK Provence logo leather sandals Neutrals HW0HW03128PBO,
LAMUNT Emma waterprood hooded coat Yellow 8550169,
P.A.R.O.S.H. textured short-sleeve sweater Blue RENFIELDD540939,
Max Mara ruffled sleeveless top Black 2616941024600,
Pre-Owned Alexander Wang asymmetric midi dress Green NAPPUGBCL363982W,
DONDUP flared trousers Neutrals DP878JS0316DXXX706,
Uma Wang geometric-print draped asymmetric dress Brown S6WUW5042,
Junya Watanabe x Innerraum gathered-detail shoulder bag Black JQK203,
Uma Wang Klarke geometric-pattern jacket Brown S6WUW6068,
Tommy Hilfiger striped platform flip-flops Blue FW0FW09195,
sacai striped pocket shirt Blue 2608480,
Calvin Klein CK Provence cut-out strap leather sandals Black HW0HW031280GJ,
sacai pleated panel skirt Black 2608519,
P.A.R.O.S.H. waffle-knit short-sleeve T-shirt Blue RENFIELDD540939,
P.A.R.O.S.H. waffle knit T-shirt Neutrals RENFIELDD540939,
P.A.R.O.S.H. V-neck blouse Blue SAXSOND311724,
P.A.R.O.S.H. patterned top Brown SOYD311521,
The North Face small Base Camp Duffel bag White NF0A52STN8V1,
Alexander Wang denim pike medium tote bag Blue 20226K64T,
Alexander Wang denim punch medium tote Blue 20226T65T473,
Max Mara side-slit midi dress Blue TONPUGBCL500605W,
Saucony ProGrid Omni 9 sneakers Silver S7073942,
Uma Wang Alex asymmetric dress Brown S6WUW5069,
K. Jacques Caicea ankle-strap braided leather sandals Silver CAICEA,
Uma Wang Tate geometric-pattern shirt Brown S6WUW1006,
K. Jacques Alaric caged sandals Brown ALARIC,
Missoni top in viscose with floral pattern and halter neckline Red MC23SK01BR014I,
Missoni zigzag-knit pleated midi skirt Neutrals DS26SH12BK01HZ,
12 STOREEZ button cover-up Black 130481,
12 STOREEZ button lightweight denim shirt Blue 131957,
12 STOREEZ 132 slim-fit jeans Blue 136372,
12 STOREEZ fitted T-shirt Neutrals 136518,
12 STOREEZ Stratum cardi-coat Brown 136426,
12 STOREEZ Mykonos shirt Grey 137343,
12 STOREEZ button cover-up White 130480,
12 STOREEZ Stratum cardi-coat Neutrals 136427,
Chloé collarless cropped jacket Purple CH26SVE0106156A,
Givenchy flap-pocket mini skirt Black BW410T15CT,
Marge Sherwood Soft Boston Ew embossed logo shoulder bag Grey GG047651,
Marge Sherwood Grandma Used Sling shoulder bag Grey GG630011WHTGREY,
Moncler striped embroidered polo shirt Blue L10939A00006M5732,
The North Face wind wall ripstop jacket Yellow NF0A8GE4GM41,
RRD square-neck shirty top White 2671309,
Kangra openwork V-neck T-shirt Neutrals 360426201,
Castañer Fresa woven double strap sandals Neutrals 025553202,
Patrizia Pepe strapless flared-leg jumpsuit Green 2T0013J415,
Patrizia Pepe Bubble rhinestone-embellished shoulder bag Silver 2B0181M017FBF8,
Patrizia Pepe midi ruched dress Yellow 2A3081JZ26,
Patrizia Pepe buttoned cropped shirt Blue 2C1665D9A0,
Patrizia Pepe buttoned knitted polo shirt Grey 2K0376K336,
Patrizia Pepe racerback jersey tank top Grey 2M4543J419,
Patrizia Pepe maxi bustier halter dress Black 2A3035A737,
Patrizia Pepe bead-embellished halterneck top Black 2C1691A740,
Patrizia Pepe Nature Soul bracelet Neutrals 2J2625M096W417,
Patrizia Pepe leather sandals Black 2X0064L026K103,
Patrizia Pepe halterneck satin top Neutrals 2C1691A740,
Patrizia Pepe sphere fly-motif ear cuff Gold 2J2606M091,
Patrizia Pepe large In My Space mesh shoulder bag Green 2B0180A778,
Patrizia Pepe zip-fastening cropped top Neutrals 2C1672A9B9,
Patrizia Pepe sphere-shape earrings Gold 2J2605M091,
Patrizia Pepe pleated midi skirt Yellow 2G1053A733,
Patrizia Pepe belt-loop pocket trousers Grey 2P1745A737,
Patrizia Pepe maxi cut-out satin dress Black 2A3065A772,
Patrizia Pepe sphere-link necklace Gold 2J2607M091,
Patrizia Pepe medium Bubble leather shoulder bag Neutrals 2B0182L182,
Patrizia Pepe draped ruched midi skirt Grey 2G1065J333,
Patrizia Pepe maxi jewel insert dress Green 2A3048A775,
Patrizia Pepe chain-detail mini dress Pink 2A3084A736,
Patrizia Pepe floral-lace bra Black 2I0174A781,
Patrizia Pepe slash-pocket pants Purple 2P1776A411,
Patrizia Pepe tapered trousers White 2P1774A733W146,
Patrizia Pepe lace-panelled V-neck bralette Grey 2I0144A602,
Patrizia Pepe asymmetric gathered top Grey 2M4528J333,
Patrizia Pepe V-neck mini dress Black 2A3080A9B9,
Patrizia Pepe lace-detail sleeveless top Neutrals 2C1686A779,
Patrizia Pepe small In My Space mesh shoulder bag Pink 2B0153A778B884,
Patrizia Pepe straight-leg poplin trousers Black 2P1750A743,
Patrizia Pepe striped belted midi dress White 2A3092A544,
Patrizia Pepe V-neck maxi dress Orange 2A3076A733,
Patrizia Pepe asymmetric ruched top Pink 2C1697A739,
Patrizia Pepe ribbed logo-embroidered T-shirt Black 2M4522J407,
Patrizia Pepe Nature Soul chunky bracelet Brown 2J2626M096,
Patrizia Pepe stripe-pattern logo-patch scarf Brown 2F0151A552,
Patrizia Pepe devoré organza midi skirt Green 2G1079A756,
Patrizia Pepe small Bubble leather shoulder bag Gold 2B0161L031,
Patrizia Pepe long-sleeve belt blazer Pink 2S1563A411,
Patrizia Pepe asymmetric-neck ruffled-detail maxi dress Red 2A3012JZ26,
Patrizia Pepe mesh crossbody bag Pink 2B0180A778,
Patrizia Pepe stripes belt mini shirt dress White 2A3093A544,
Patrizia Pepe jewel-detail V-neck blouse White 2C1729A739,
Patrizia Pepe crystal-embellished sphere ear cuff Silver 2J2606M097,
Patrizia Pepe logo-intarsia tote bag Orange 2B0175K264J513,
Patrizia Pepe bead-embellished georgette top Neutrals 2C1684A750,
Patrizia Pepe Draped long dress Neutrals 2A3049A737,
Patrizia Pepe crochet-knit pareo scarf Neutrals 2F0138K338,
Patrizia Pepe denim bermuda shorts Blue 2P1769D1WZB,
Patrizia Pepe belt-loop pocket shorts Neutrals 2P1760A052,
Patrizia Pepe lace-detail asymmetric dress Black 2A3063A776,
Patrizia Pepe asymmetric-arm maxi dress Grey 2A3021A738,
Patrizia Pepe logo-detail shirt midi dress Blue 2A3014D9A0,
Patrizia Pepe Fly logo-plaque denim mini skirt Blue 2G1058D070,
Patrizia Pepe zip-fastening cropped top Brown 2C1672A9B9,
Patrizia Pepe straight-leg jeans Blue 2P1772D070CB21,
Patrizia Pepe knitted polo dress Green 2A3030K328,
Patrizia Pepe pink trousers Pink 2P1775A737,
Patrizia Pepe Fly-plaque leather belt Pink 2W0031L048,
Patrizia Pepe mesh shoulder bag Black 2B0153A778,
Patrizia Pepe belted maxi dress White 2A3006A9B9,
Patrizia Pepe cut-out detail maxi dress Pink 2A3065A772,
Patrizia Pepe V-neck maxi dress Neutrals 2A3034A740W146,
Patrizia Pepe Midi wave-print dress Grey 2A3052J423,
Patrizia Pepe ruffled floral-print midi dress Pink 2A3090A765,
Patrizia Pepe mesh shoulder bag Black 2B0125A778,
Patrizia Pepe logo-plaque clutch bag Pink CB5460L011,
Patrizia Pepe halterneck cape scarf Neutrals 2F0133AD08W418,
Patrizia Pepe In The City logo-print clutch bag Orange 2Q0014K264,
Patrizia Pepe V-neck maxi dress Neutrals 2A3034A740,
Patrizia Pepe Fly-plaque buckle belt Black 2W0029L162,
Patrizia Pepe halter tailored vest Neutrals 2C1726A735,
Patrizia Pepe floral-embroidery midi dress White 2A3069A773,
Róhe collar pocket jacket Blue 41911228,
Solace London Lottie maxi dress Blue OS47003,
The Mercer Brand crew-neck T-shirt Green MEAP241002,
Ba&Sh ribbed embroidered T-shirt Neutrals 1E25CAST,
Prada Pre-Owned 2013-2026 Mini Terry Re Edition 2000 shoulder bag White 6JY2BWHAH569NTF7,
JcSophie elasticated trousers White L3133,
JcSophie elasticated palazzo pants Black L3133,
Emporio Armani logo-plaque mules Black EW004060AF21961UC001,
Jacquemus the Picot bikini bottom Black BOW00625AJ00135,
Jacquemus the Picot bikini top Black TOW00886AJ00135,
YANYAN KNITS floral-appliqué T-shirt Neutrals YYWT260771,
YANYAN KNITS YY T-shirt Neutrals YYWT260781,
JcSophie striped trousers Blue L3135,
ASICS Dry "Black" tank top Black WR31270904,
adidas snakeskin stripe sneakers Black KH9019,
Barbara Bui lace-up tiered maxi dress Green H1340REK47,
Barbara Bui macramé-detail pleated maxi dress Neutrals H1343REK2131,
Burberry Pre-Owned 2000-2017 Nova Check Canvas crossbody bag Brown 63887LZ830F67FNA,
Ferragamo Pre-Owned 2000-2026 Leather Vara Bow shoulder bag Black YBN4D8BVUO4SURE4,
120% Lino linen shirt Neutrals 33ALIW1PKM,
Moncler Gumiane quilted logo-patch gilet Neutrals L10981A00019597X6,
Dr. Martens Lowell derby shoes Black 42445001,
Michael Michael Kors Jaida asymmetric slingback sandals Neutrals 40S6JDMS3L289LTCREAM,
120% Lino wrap-style tie-fastening shorts Brown 33ALIW29RP000011500092,
Haikure Korea distressed wide-leg jeans Blue HEW03323DF203L0936,
'S Max Mara striped linen T-shirt Black 2619361033600,
Saint Laurent cable-link bracelet Gold 857625Y1500,
Forte Forte scalloped-trim top Neutrals 14888MYTSHIRT,
Forte Forte button-up blazer Pink 14825MYJACKET,
HIDESINS leather tote bag Black LB27NLBLK,
Paris Texas stiletto-heel sandals Silver PX1950XNPMRSILVER,
Forte Forte striped drawstring-fastening trousers Red 14820MYPANTS,
HIDESINS Flap leather tote bag Red FL12TRWNE,
Roger Vivier buckle-strap sandals Gold RVW80544440KACG005,
Roger Vivier Viv' on the Run sandals Black RVW80044270V4CB999,
Golden Goose Star crystal-embellished sweater Grey GWP02699P002514,
adidas Samba OG sneakers Neutrals IH9059,
Balenciaga suede combat shoes Brown 867709WCB45,
GANNI Posy shoulder bag Black B2110071,
K. Jacques Aldwin strappy sandals Neutrals ALDWIN,
K. Jacques Aldwin strappy sandals Brown ALDWIN,
K. Jacques Hecatea leather sandals Brown HECATEA,
Missoni zigzag-knit ruffled mini skirt Red MC26SH00BR014I,
12 STOREEZ leather wallet Brown 130323,
12 STOREEZ open-back swimsuit Grey 130414,
12 STOREEZ asymmetric mini dress Purple 134905,
12 STOREEZ Rosie cardi-coat Black 137173,
12 STOREEZ 821 balloon-leg jeans Blue 132975,
12 STOREEZ ribbed tank top Neutrals 131364,
12 STOREEZ Camelia V-neck cardigan Pink 135826,
12 STOREEZ flared denim shorts Blue 136362,
12 STOREEZ 433 wide-leg jeans Blue 132979,
12 STOREEZ Stratum T-shirt Brown 136422,
12 STOREEZ bowling denim shirt White 136359,
12 STOREEZ pinstripe blazer midi dress Black 133361,
12 STOREEZ Simone shirt White 137581,
12 STOREEZ Diana slingback pumps Grey 136494,
12 STOREEZ asymmetric draped mini dress Grey 135512,
12 STOREEZ flared denim shorts Grey 136374,
12 STOREEZ Cannes top Black 136144,
Marge Sherwood XL Grandma Used heart keychain tote bag Black GG631260,
AMI Paris logo-embroidered bucket hat Neutrals UHA682AW0041,
SANTHA ImSouAne checkerboard-print sneakers White YU05IMCNCH,
La Piscine wrinkled trousers set White LS261WP006RA006,
The North Face Red Box belted shorts Green NF0A8FHD,
La Piscine belted epaulettes jacket Green LF261WO004TW003,
Kangra openwork V-neck T-shirt Brown 360426251,
RRD square neck tank top Blue 2671360,
K-Way logo pattern luggage Blue K4125ZW,
Halmanera Dave tapered leather sneakers Black DAVE05NERO,
Dr. Martens Jadon TP heart-plaque platform boots Black 42099001BLACK,
K-Way Laon ripstop padded backpack Green K2116RW,
Sergio Levantesi Genny woven sandals Brown GENNY6PITONE,
Castañer embroidered platform sandals Black 026213100,
Patrizia Pepe mini torçon dress Grey 2A3091A411,
Patrizia Pepe mini sweetheart-neck jersey dress Green 2A3011JZ26,
Patrizia Pepe color-block maxi dress Red 2A3022J333,
Patrizia Pepe rhinestone-embellished crop top Pink 2C1694A737,
Patrizia Pepe belt-loop pocket trousers Green 2P1777A411,
Patrizia Pepe logo-detail midi dress Silver 2A3040J242,
Patrizia Pepe mesh crossbody bag Black 2B0180A778,
Patrizia Pepe midi bustier poplin dress Grey 2A3005A743,
Patrizia Pepe asymmetric draped pareo Neutrals 2F0154A653,
Patrizia Pepe poplin short-sleeve jumpsuit Black 2T0095A9B9K103,
Patrizia Pepe ribbed racer-back tank top Yellow 2M4545J429,
Patrizia Pepe V-neck draped top Black 2C1671A743,
Patrizia Pepe tie-embellished single-breasted blazer Neutrals 2S1558A052,
Patrizia Pepe poplin straight-leg trousers Grey 2P1750A743,
Patrizia Pepe long-sleeve buttoned blazer Green 2S1554A411,
Patrizia Pepe square-toe sandals Silver 8X0117L031S731,
Patrizia Pepe kimono dress Pink 2A3058AD08,
Patrizia Pepe zip-fastening cropped top White 2C1672A9B9,
Patrizia Pepe fly-pendant necklace Silver 2J2641M085Z005,
Patrizia Pepe small In My Space mesh shoulder bag Green 2B0153A778G632,
Patrizia Pepe pinstripe-pattern maxi dress Brown 2A3097A552,
Patrizia Pepe frayed-hem shorts Blue 2P1744D070,
Patrizia Pepe one-shoulder midi dress Neutrals 2A3016A748,
Patrizia Pepe ribbed racer-back tank top White 2M4545J429,
Patrizia Pepe ring-detail jumpsuit Red 2T0101J333,
Patrizia Pepe cut-out satin jumpsuit Grey 2T0097A736,
Deus Ex Machina stripe drawstring shorts Blue DLP233917,
Jacquemus the Salon Maïs clutch Yellow BAW00413AC09A13,
YANYAN KNITS printed T-shirt Neutrals YYWT260941,
JcSophie striped button mini dress Blue L3136,
adidas logo-lettering T-shirt White KC8140,
Fendi Pre-Owned 2000-2010 Zucchino Canvas handbag Black ZQTPDF49CAL6YJ6V,
Jordan Retro Explorer XX "Midnight Navy" sneakers Blue BQ0006401,
ASICS Gel Lyte Classic sneakers White 1202A011100,
adidas Tokyo Mary Jane touch-strap ballet flats Pink IH4000,
Oliver Peoples Sonia rectangle-frame sunglasses Neutrals OV5609SU,
Celine Pre-Owned 2017 Medium Calfskin Classic Box crossbody bag Pink JVF5UFKGGR7YMTV0,
Givenchy double-breasted mini dress Black BW22QP15CT,
Lauren Ralph Lauren boat neck cuffed T-shirt Neutrals 200654963,
120% Lino linen palazzo pants Yellow 33ALIW29RN,
120% Lino linen shirt Green 33ALIW1PKM,
Max Mara pleated straight-leg trousers White 2611131072600,
Moncler quilted keychain Black L209B6F00001M6275,
Manebi medium Panier gradient raffia shoulder bag Pink V99EB,
Forte Forte striped trousers Neutrals 14820MYPANTS,
Forte Forte daisies earrings Silver 14686MYJEWEL,
Forte Forte elasticated-waistband trousers White 14834MYPANTS,
Filson patch-pocket denim jacket Blue FWCPS0075,
Maurizio Braschi lace tie-back top Black W08603081,
Tagliatore button-up waistcoat Purple GRACIE340297U,
GIANNI CHIARINI lase-cut tote bag Black BS11507COMMCNVLS,
Roger Vivier Marlene crystal silk pumps White RVW78943010RS0C001,
Gianfranco Ferré Pre-Owned leopard-print cotton scarf Pink WCV241099,
Gianfranco Ferré Pre-Owned patterned foulard scarf Grey WCV241096,
Gianfranco Ferré Pre-Owned crowd-pattern silk scarf Blue WCV241095,
Orciani appliqué drawstring tote bag Neutrals B02233,
Skagen Essential Waves sculptural open-band rings Gold SKJ1788710,
La Mania drawstring track pants Black COMFY3,
La Sportiva logo-print race gloves Black Y60999100,
La Sportiva logo-print elasticated belt bag Black Y85999999,
La Sportiva Wool40 Aero base layer Black ZASB005,
Skagen Anja hoop earrings Silver SKJ1849040,
Superga 2750 striped sneakers Red S8148TWAD4,
Superga 2750 sneakers Pink S001820A1F,
Vivienne Westwood Thames Orb bracelet Silver 6102025P02P409,
Vivienne Westwood Hazel cotton bag Neutrals 46020010WW01D0B402,
Barbour tartan logo-patch dog blanket Red DAC0127,
Elisabetta Franchi Red Carpet dress in satin with elastic straps Black ABR5362E2,
Elisabetta Franchi rings-detail mesh bucket bag Black BS04A62E2,
Elisabetta Franchi Red Carpet dress in crêpe jersey Brown ABR4762E2,
Givenchy button denim jacket Blue BW00VD517Z,
ISABEL MARANT Oskan coin-embellished suede cross body bag Brown BF0066FHD2C16M,
Sergio Levantesi Rebel6 crossed-strap sandals Black REBEL6,
GIANNI CHIARINI Sienna leather bucket bag Neutrals BS11786RNGDBLSABBIA,
Aeyde criss-cross strap sandals Black HS0163005001BLACK,
Sergio Levantesi Viky6 sandals Neutrals VIKY6IVORY,
Kangra sequin-embellished V-neck blouse Green 373002847,
Kangra sequin-embellished buttoned cardigan Brown 390261833,
Vaquera graphic-print tank top Black VAQ11T025BLACK,
kaos crewneck cotton T-shirt Blue SP5BR0053000,
RRD buttoned vest White 2675209,
AGOLDE five-pocket denim shorts Black A91271817PHA,
kaos Icona darts-detail crew-neck T-shirt Black SP5BR0050001,
RRD buttoned vest Grey 2675260,
GIANNI CHIARINI Grain leather wallet Neutrals PF5041TKLCLAY,
RRD buttoned long-sleeve shirt White 2675409,
GIANNI CHIARINI zip leather wallet Black PF5042NANERO,
The Garment Como ribbed short-sleeve sweater Red 20602152,
Osoi Bucket Brocle leather shoulder bag Neutrals 26SB05013295MAPLE,
Vaquera logo-print shoulder-pad hoodie Black VAQ11T029BLACK,
Dr. Martens Buzz 5-Eye pink-stitching trainers Black 42112001BLACK,
Osoi Tote Brocle leather bag Brown 26SB05008295MAPLE,
Celine Pre-Owned 2000 Macadam Coated Canvas tote bag Brown KXI8Q0GTGHG0LHP1,
Louis Vuitton Pre-Owned 2004 Damier Ebene Belem PM handbag Brown BMMHGECMFUDLMCY1,
Trussardi embellished chain necklace Gold TJAYY02,
Trussardi embellished hoop earrings Silver TJAXC33,
Trussardi T-logo round-charm chain bracelet Gold TJAXC58,
Trussardi circle-charm bracelet Gold TJAXB08,
Trussardi crystal-embellished necklace Silver TJAYY03,
Trussardi cotton T-shirt Red G1156000243N,
Trussardi twisted bracelet Silver TJAXA02,
Trussardi Cameo card holder Green I023E000129N,
Trussardi circle link bracelet Gold TJAXC111,
Trussardi embroidery T-shirt Red G1336000245N,
Trussardi logo crystal bracelet Gold TJAXC29,
Toms square-toe ballet flats Black 10020665,
Trussardi logo-detail bracelet Silver TJAXC30,
Trussardi crystal-embellished band ring Gold TJAYY110,
Trussardi T-logo hoop earrings Silver TJAXC32,
Toms Rope 2.0 espadrilles Green 10020859,
Trussardi crystal-embellished logo-pendant necklace Gold TJAXC10,
Trussardi crystal-embellished drop earrings Silver TJAXA27,
Trussardi interlocking ring necklace Gold TJAXB07,
Toms logo-patch sneakers Blue 10021887,
Toms Rope 2.0 espadrille Black 10020687,
Trussardi heart embellished necklace Silver TJAXC44,
Trussardi stone-pendant necklace Gold TJAXA20,
Toms Carolina rope-trim espadrilles Neutrals 10020711,
Toms Abby knot-detail espadrille slides Black 10021978,
Baobab Malaki beach cover-up Pink 6991066,
A.P.C. Dan chinos Blue COHNEH08028,
Craig Green embroidered parka Brown CGSS26CWOJKT108,
Carhartt WIP logo-embellishment hat Pink I036381,
Simone Rocha cutout ballerina sneakers Brown BPT10B0755,
CARRANO buckle-fastening sandals Gold 405014,
CARRANO buckle-fastening ankle-strap sandals Black 405014,
K-Swiss Lozan Klub sneakers White 97263,
North Sails slim-fit shorts Pink 074775,
North Sails pleated shorts Blue 074776,
Gianfranco Ferré Pre-Owned printed silk scarf Black WCV241098,
V°73 Keira wallet Yellow 73PS9D1251KEIRAVANIGLIA,
V°73 Keira logo wallet Yellow 73PS9D1258KEIRAVANIGLIA,
Gucci Pre-Owned snake-print chiffon scarf Pink WCV241069,
V°73 Keira logo wallet Neutrals 73PS9D1251KEIRAOFFWHITE,
V°73 Keira wallet Neutrals 73PS9D1258KEIRAOFFWHITE,
Vintage beaded-embellishment dress Red W2111161,
Gianfranco Ferré Pre-Owned chita-print silk scarf Brown WCV241093,
Etro Vintage floral-print cotton scarf Purple WCV241088,
Loro Piana Unique Stole scarf Neutrals FAQ6785,
Gianfranco Ferré Pre-Owned 2019 patterned long-sleeved top White MZ1913448,
Soeur Irving check-pattern blouse Brown CHE0770IRVINGMAR8126S,
La Sportiva round-neck T-shirt Yellow M30736736,
La Mania logo-detail ribbed leggings Black CARE,
Superga 3740 leopard-print sneakers Neutrals S2137ZWAB4,
La Sportiva logo-detail short-sleeve T-shirt Blue Q31644643,
La Mania logo-detail track pants Neutrals COMFY3,
Skagen geometric drop earrings Pink SKJ1816791,
Skagen Sofie round-shape drop earrings Silver SKJ1812040,
La Sportiva graphic-print flip flops White 18B402602,
Skagen Moderne Stak snake-chain necklace Gold SKJ1872710,
Skagen Sofie Sea bracelet Silver SKJ1811040,
Superga 2740 striped platform sneakers Blue S2136YW,
Marni chain-link necklace Gold COMV0556A0,
Pennyblack flap-pocket blazer Brown 2611041183200,
LENA HOSCHEK ribbon-detail A-line midi skirt Neutrals SWINGRIBBON,
Givenchy denim midi skirt Blue BW412X517Z,
Borsalino metal-logo baseball cap Black B95174EBAA0026068B,
Casablanca Stade logo-patch sneakers White SNK02409W,
TOTEME sleeveless top White 252WRT0508FB0192,
Trussardi logo-embroidered T-shirt Black G1086000240N,
Trussardi animal-shape earrings Silver TJAXB05,
Trussardi crystal-embellished ring Gold TJAXC410,
Toms camouflage espadrilles Grey 10016101,
Trussardi crystal-embellished T-motif bracelet Gold TJAXC18,
Toms Classic slip-on sneakers Neutrals 10020656,
Trussardi crystal-embellished double-chain bracelet Silver TJAXC27,
Trussardi charm chain bracelet Gold TJAXC24,
Trussardi Cameo leather card holder Black I023E000129N,
Trussardi pendant-detail bracelet Silver TJAXC22,
Trussardi embroidered graphic T-shirt White G1156000243N,
Trussardi sculptural hoop earrings Silver TJAXA06,
Toms frayed platform espadrilles Black 10019795,
Trussardi embroidered T-shirt Pink G1086000240N,
Toms crochet flat espadrilles Black 10016254,
Toms Kira sandals Black 10020802,
Toms Carolina frayed espadrille sneakers Black 10021856,
Trussardi organic-shape earrings Gold TJAXA05,
Toms Rope 2.0 slip-on espadrilles Neutrals 10020695,
Toms Abby buckle-fastening sandals Black 10020814,
Trussardi irregular hoop earrings Gold TJAXA03,
Trussardi crystal-embellished band ring Gold TJAXC390,
Trussardi half-hoop earrings Gold TJAXC34,
Toms Sloane sandals Neutrals 10020808,
Trussardi two-tone hoop earrings Gold TJAYY09,
Trussardi crystal-embellished logo-plaque necklace Silver TJAXC05,
Trussardi crystal-embellished bangle bracelet Silver TJAYY06,
Trussardi Greyhound-detail hoop earrings Gold TJAXB11,
Trussardi crystal-embellished heart earrings Gold TJAXC49,
Toms braided trim flat espadrilles Red 10021885,
Toms Kira multi-strap buckle-fastening sandals Brown 10020825,
Trussardi crystal-embellished ring Gold TJAXA290,
Baobab Lula bikini top Green 6341194,
Baobab Kina tie-fastening top Yellow 6710394,
Baobab Nala ring-detail bikini top Pink 6971066,
Iceberg pleated striped mini skirt Blue AC017534,
Coccinelle logo-embroidered leather-trim tote bag Neutrals E1UAL180101,
Coccinelle logo-embroidered leather-trim tote bag Neutrals E1UAL180101,
Under Armour logo-detail track pants Purple 1386453,
Under Armour side-stripe tracksuit Blue 1365147,
Under Armour ColdGear logo-waistband leggings Black 6003997,
Swarovski Iphone XS Glam Rock crystal phone case Purple 5478875,
Under Armour logo detail hoodie Black 1356317,
Under Armour HeatGear UA Tech leggings Grey 1365336,
Under Armour boat-neck T-shirt Neutrals 1379150,
Swarovski Constella crystal-embellished earrings Pink 5692263,
Under Armour Train Seamless long-sleeve top Grey 1379150,
Under Armour UA Rival drawstring-waist track pants White 1379438,
Swarovski Idyllia crystal-embellished bracelet Silver 5741523,
Under Armour Unstoppable cargo trousers Brown 1386481,
Swarovski Crystalgram iPhone Xs Max phone case Blue 5533972,
Under Armour logo-strap mesh-panel sports bra Pink 1384112,
Swarovski Constella necklace Pink 5692266,
Swarovski parrot-motif iPhone XS case Blue 5533973,
Swarovski Idyllia charm Silver 5742957,
Under Armour zip hooded sweatshirt Purple 1386043,
Under Armour logo-print backpack Black 1378411,
Under Armour logo-detail tracksuit Grey 1365147,
Swarovski embellished iPhone 12 Mini case Silver 5616369,
Under Armour Infinity 2.0 high zip-up logo-strap sports bra Black 1384118,
Under Armour Lockdown 7 sneakers Black 3028512,
Under Armour ColdGear textured half-zip long-sleeved top Red 6003998,
Under Armour Icon sweatshirt Black 1386495,
Under Armour long-sleeve piped-trim top Black 6003998,
Under Armour logo-print long-sleeves T-shirt Green 1379150,
Swarovski Matrix crystal-pearl stud earrings Silver 5747752,
Under Armour UA Rival Tricot tracksuit Black 6001966,
Under Armour Rival drawstring kangaroo-pocket hoodie Purple 1379500,
Under Armour UA Vanish seamless panelled leggings Pink 6000646,
Under Armour logo-detail tracksuit set Black 1365147,
Under Armour logo-print tracksuit Pink 6001966,
Under Armour UA Launch Pro thumbhole zip-detail sweatshirt Black 1379349,
Swarovski crystal-embellished ring Silver 5007779,
Jacquemus belt-loops jeans Blue PAW00036AD00054,
Raquel Diniz abstract foulard scarf Neutrals ZFS0001,
Raquel Diniz Bina lace shirt Neutrals A00301840977,
Raquel Diniz Bahia striped shirt Neutrals A003007,
Raquel Diniz Bahia lace shorts White 9003005,
Prada Re-edition 2005 Re-nylon bag Black 1BH204VV9LR064,
Coccinelle Koi leather-detail bucket bag Brown E1U2Q230101,
Coccinelle logo-lettering leather shoulder bag Black E1U7K150101,
My Myths wide-leg trousers Brown 26D4185,
TWINSET pointelle-knit T-shirt Neutrals 261TT3081,
Balenciaga Cocoon leather jacket Brown 871987TUS11,
Y-3 Gazelle suede sneakers Grey KI4341,
CARRANO ruched crossover-strap sandals Brown 322078,
Moschino collared buttoned top Black A09050406,
Jil Sander satin trousers Grey J02KA0180J65022030,
CARRANO buckle-fastening strap sandals White 405014,
CARRANO patent leather sandals Red 189093,
CARRANO strappy stiletto sandals Neutrals 189093,
CARRANO buckle-fastening pointed-toe sandals Neutrals 816001,
CARRANO multi-strap metallic sandals Silver 917008,
CARRANO buckle-fastening metallic sandals Silver 539009,
CARRANO snake-effect buckle-fastening sandals Neutrals 539009,
CARRANO ruffled slingback flat sandals Neutrals 507113,
Lauren Ralph Lauren off-shoulder midi dress Blue 253982166,
Self-Portrait ruffled cowl-neck maxi dress Pink SS26272X098,
CARRANO ruffled pointed-toe flat pumps Black 507113,
CARRANO ruffled buckled sandals Silver 951001,
CARRANO ruffled buckle-fastening sandals Neutrals 951001,
CARRANO twisted-strap square-toe sandals Silver 780004,
CARRANO twist-detail metallic-effect sandals Brown 780004,
CARRANO patent-finish square-toe mules Red 513001,
CARRANO patent-finish square-toe mules Neutrals 513001,
GIANNI CHIARINI laser-cut tote bag Black BS11506COMMCNVLS,
Axel Arigato Area Lo logo-print sneakers Neutrals F3904001,
Lanvin bow long sleeve top Black RWTS0029J055P2,
CHANEL Pre-Owned 1991-1994 Caviar Chevron Tassel Camera Case crossbody bag Black ZBYSITM47CA47YH1,
Alevì strappy metallic leather sandals Gold L26SD00451309G03,
Themoirè Tallia handle tote bag Neutrals 261WTMTS0OOBC,
Palm Angels Claire cat-eye sunglasses Black PERI10ES25PLA0011007,
Antonelli Luna panelled maxi dress Purple Q6648355C,
Palm Angels Miracle cat-eye sunglasses Black PERI10FS25PLA0011007,
Palm Angels Magnolia rectangular sunglasses Brown PERI10JS25PLA0016055,
Alevì glass-embellished sandals Silver L26SN00350222453,
Antonelli Becky embellished cowl-neck blouse Brown BECKYQ5602794,
Christian Dior Pre-Owned 2010-2026 Diorissimo Trotter Canvas Doctors Bag handbag Blue KZX32PYZNXASJI8F,
Tagliatore single-breasted suit Blue TPARIGI15KAD520060,
Uma Wang Pansy dot-print trousers Neutrals UW3021,
Zadig&Voltaire Perya jeans Blue WWJE01327,
Lauren Ralph Lauren pocket mini skirt Blue 200P03461001,
Lauren Ralph Lauren buttoned pocket cardigan Blue 200P03460001,
Under Armour piped long-sleeve top Black 6003999,
Under Armour stripe-detail tracksuit Grey 1365147,
Swarovski Lucent crystal-embellished octagonal keyring Silver 5669119,
Swarovski embellished iPhone X case Red 5481454,
Under Armour zip-up logo-print hoodie Black 1386043,
Under Armour Rival Woven jacket Black 6004849,
Under Armour logo-detail tracksuit Pink 1365147,
Under Armour logo-print leggings Orange 1381662,
Under Armour hooded zip-up lightweight jacket Pink 6004849,
Swarovski Matrix Vittore crystal-embellished eternity ring Pink 5656301,
Under Armour seamless racerback sports bra Pink 1384419,
Under Armour logo crew neck sweater Black 6003675,
Under Armour Tech performance leggings Blue 1365336,
Under Armour cargo-pockets track trousers Neutrals 1382696,
Swarovski Matrix Vittore crystal-embellished eternity ring Pink 5655706,
Swarovski crystal-embellished watch case Silver 5663567,
Under Armour logo-detail sweatshirt Grey 6007035,
Under Armour side-pocket leggings Purple 1365336,
My Myths double-breasted blazer Neutrals 26D2178FR,
Self-Portrait bow embellished drop earrings Silver SS26615ESL,
Alysi sheer-finish scarf Neutrals 116611P6214,
Coccinelle grained leather tote bag Black E1UAK180101,
Kangol paisley-pattern bucket hat Orange K3549,
Kangol tie-dye beanie hat Blue K3795,
Kangol quilted-design bucket hat Black K4373,
Kangol mesh-panelled baseball cap Neutrals K5440,
Alysi asymmetric maxi dress Pink 116360P6223,
Alysi V-neck tied maxi dress Neutrals 116334P6204,
Alysi graphic-print slit skirt Green 116034P6223,
Alysi geometric slit skirt Pink 116034P6223,
D.Exterior puff-sleeves shirt Brown 62682A,
Givenchy printed T-shirt White BW70FJP7FQ,
LIU JO regular-fit waistcoat Pink CA6222T2200,
Manolo Blahnik Haribal sandals Neutrals 219011900282601,
Stella McCartney Dartmoor drawstring flap backpack Black 7B0194WP0670,
S.T. Dupont Biggy lighter Orange 25063,
S.T. Dupont Slimmy lighter Blue 28064,
S.T. Dupont Biggy lighter Silver 25064,
S.T. Dupont Slimmy lighter Orange 28063,
IRO Island tiered island dress Green WM33ISLAND,
Les-Ottomans ikat-print cushion Pink V73740X50S,
Les-Ottomans horse-print velvet cushion Brown V77740X50S,
Les-Ottomans ikat-print cushion Blue V0140X50S,
Les-Ottomans ikat-print cushion Blue V10040X50S,
Les-Ottomans ikat-pattern cushion Orange V77640X50S,
Les-Ottomans ikat-print cushion White S23940X60S,
Les-Ottomans ikat-pattern cushion Pink S24040X60S,
Les-Ottomans ikat-print silk cushion Blue SI2950X50S,
MM6 Maison Margiela lettered T-shirt Black S62GD0212M20108,
Les-Ottomans ikat-print cushion Neutrals S19740X60S,
Les-Ottomans ikat-print cushion Green S3240X60S,
Les-Ottomans ikat-print cushion Green V43140X50S,
Les-Ottomans ikat-print silk cushion Brown SI3250X50S,
Les-Ottomans ikat-pattern cushion Neutrals S35240X60S,
Les-Ottomans ikat-pattern cushion Green S33940X60S,
Les-Ottomans ikat-print cushion Neutrals V0940X50S,
Closed Nikka striped jeans Black C2118919S28,
Carhartt WIP Brandon trousers Brown I034809,
Saint Laurent Cassandre cardholder Black 423291BOW08,
Innerraum Object C03 shoulder bag Silver C03DSBKPV00,
Givenchy medium Antigona bowling bag Grey BB515CB2D6,
Kangol floral-intarsia beret Red K3750,
Kangol Anemone Lahinch bucket hat Black K3747,
Kangol Tropic™ Ventair baseball cap Green 1456BC,
Kangol Pearl bow beanie hat Neutrals K3794,
Kangol fluffy beanie hat Black K3791,
Kangol logo-embroidered patterned bucket hat White K3554,
Kangol logo patch wool cap Black K3660,
Kangol Block Zig beret Brown K5472,
Kangol cable-knit pompom beanie hat Neutrals K4460SM,
Kangol logo-embroidered beanie hat Black K3661,
Kangol logo-embroidered bucket hat Green K3451,
Kangol terry towelling bucket hat Green 0397BC,
Kangol Cozy Cord Earflap baseball cap Brown K5470,
Kangol black balaclava hat Black K5420,
Kangol Stay Puffed bucket hat Black K5354,
Kangol Salvaged Outdoor logo-detail sun hat Black K5437,
Kangol Tropic Ventair Spacep logo baseball cap Red 1456BC,
Kangol Tropic Bin bucket hat White K3299HT,
Kangol logo-appliqué bucket hat Red K5335,
Kangol Mega leopard-print trapper hat Black K5467,
Kangol floral-pattern bucket hat Red K3751,
Kangol New Heritage flat cap Black K3778,
Kangol pompom cable-knit beanie hat Neutrals K4460SM,
Kangol embroidered-detail hat Grey K5368,
Kangol embroidered-detail cap Black K5466,
Kangol Cord corduroy logo-embroidered baseball cap Neutrals K5206HT,
Kangol pearl-bow beanie hat Pink K3794,
Kangol herringbone hat Black K4269HT,
Kangol logo-detail bucket hat Red K3181,
Kangol fleece-texture embroidered baseball cap White K5466,
Kangol Seamless Tropic™ 507 cap Neutrals K3569,
Kangol Mega Trapper hat Blue K5467,
Kangol gradient-effect ribbed-knit beanie hat Green K3795,
Kangol two-toned bucket hat Pink K3745,
Kangol cable-knit pom-pom beanie hat Neutrals K4460SM,
Kangol New Heritage flat cap Brown K3778,
Coccinelle debossed-logo leather tote bag Blue E1UAK180101,
GANNI twisted bodysuit Black A1040351,
IRO Island maxi dress Black 26SWM33ISLANDBLA,
GANNI pants in cotton crochet White A1080122,
Les-Ottomans Ikat-print cushion White S17040X60S,
Les-Ottomans ikat-pattern cushion Green S10240X60S,
Les-Ottomans ikat-print cushion Brown S17740X60S,
Ermanno Scervino Majarobuckle-fastening belt Neutrals D483T300RDIW,
Séfr Siobhan shirt White SIOBHAN,
Séfr Daphne palazzo pants Neutrals WSS26DAPHNECLO,
CHANEL Pre-Owned 2016-2017 Quilted Calfskin CC University Flap satchel Black WSPZY242SGUJYNT9,
CHANEL Pre-Owned 2019 CC Lambskin Camera Bag crossbody bag Black W6F152X9BYH6P8PV,
Alaïa button-up cotton shirt Yellow AA9C1010T611C,
Alaïa triangle clip-on earrings Gold AAJE1061LA006,
IRO Safrina racerback tank top Black WM19SAFRINA,
adidas Superstar lace-up sneakers Brown IH4175,
GANNI logo-tag multi-pocket tote bag Black B2110078,
Victoria Beckham check pocket shirt Neutrals 1226WSH007474D,
Victoria Beckham pleated trousers Neutrals 1226WTR002857G,
Victoria Beckham chest-pocket blouse Neutrals 1226WSH007474C,
Furla large Opportunity patterned tote bag Neutrals WB00255BX4614,
GANNI floral-appliqué crochet-knit sweater Black A1070231,
adidas Superstar 3-Stripes lace-up sneakers Pink IH1673,
GANNI Posy shoulder bag Black B2110079,
Forte Forte bow-print top Neutrals 14916MYTOP,
Nodaleto square-toe buckle leather pumps Black NO46021A23040,
GANNI floral-pattern trousers Grey A1080121,
Coach zipped leather cardholder Neutrals CZ112,
GANNI logo-embroidered sweatshirt Black A1050176,
Nodaleto T-strap leather pumps Neutrals NO46021A23042,
GANNI tie-detail button-up mini dress Neutrals A1030464,
IRO Melyora sweater Neutrals WM12MELYORA,
IRO Utenia asymmetric dress Neutrals WM33UTENIA,
ODISSI T-strap buckled leather ballet flats Black OD46024A23000,
GANNI tie-detail blouse Black A1040237,
Furla large Opportunity patterned tote bag Grey WB00255BX4423,
Victoria Beckham zip cardigan Black 1226KTP007268A,
adidas Superstar Lux lace-up sneakers Black JQ4314,
Alaïa leopard-print midi skirt Brown AA9J2340W172C,
IRO Janine shirt Grey WP18JANINE,
Barbara Bui openwork tank top Neutrals H4228LXA,
Barbara Bui asymmetric button mini skirt White H1512HHN,
Barbara Bui zip-up jumpsuit Blue F1653XEF55,
LIU JO pleated shorts Brown WA6318T4818,
Barbara Bui tiered lace-up midi dress Neutrals H1340REK21,
Juicy Couture logo-waistband ribbed pajamas Black JCLAS125504,
Sisley logo-patch jeans Blue 47KZLE044,
Sisley relaxed-fit jeans Black 47RYLE04D,
Sisley slim-fit jeans Black 4TAYLF06G,
Sisley zip-up drawstring-waist gilet Black 6G6HW800Y,
Sisley V-neck cardigan Black 19VBM602B,
Sisley embellished button-up shirt Grey 5MNPLQ083,
Sisley washed-effect bootcut jeans Blue 4YRZLE03X,
Sisley pleated belt-loop trousers Neutrals 4KVXL5CM7,
Sisley round-neck sweater Black 17Q3M103J,
Sisley belt-loop trousers Black 4AI655AH6,
Sisley puffed-sleeves gathered shirt Neutrals 5V5TLQ0AE,
Sisley boat-neck sweater Brown 11BAM1A48,
Sisley boat-neck drop-shoulder sweater Green 17Q3M103J,
Sisley slim-fit jeans Blue 4TAYLF06G,
Sisley wide-leg trousers Neutrals 4KVXLF02I,
Sisley fine-knit long-sleeve top Neutrals 17Q3M100F,
Sisley ruffled-neck blouse Black 5FGXLQ0A5,
Sisley long-sleeve shirt Neutrals 5IDTLQ08R,
Sisley V-neck sleeveless midi dress Black 1276MV00T,
Sisley long-sleeve crew-neck sweater Blue 17Q3M100F,
Sisley pleated trousers Grey 4KVXL5CM7,
Sisley chunky-knit long-sleeve sweater Neutrals 145YM105A,
Sisley button-down V-neck cardigan Grey 122WL602S,
Sisley belt-loop tailored trousers Pink 4KVXLF02I,
Sisley herringbone belted vest Grey 25FALJ011,
Sisley elasticated faux-leather shorts Brown 48WPL9001,
Sisley crew-neck sweater White 17Q3M103J,
Sisley boat-neck sweater Red 11BAM1A48,
Sisley pleated trousers Neutrals 4V99LF07S,
Sisley lace-panels slit midi skirt Black 41BLL0022,
Sisley mid ruffled front-slit skirt Black 4T2VL002I,
Sisley pleated button-fastening trousers Blue 4KVXL5CM7,
Sisley V-neck fuzzy cardigan Neutrals 19VBM602B,
Sisley button pleated trousers Grey 4V99LF07S,
Sisley short belt zip skirt Blue 4WBDL001X,
Sisley V-neck button-up cardigan Blue 17Q3L603J,
FRAME The Form scoop-neck mini dress Blue 6027105CTAR,
Valentino Garavani striped bow hat Red WHGA44VMD,
Karl Lagerfeld pompom embroidered beanie hat Neutrals A1W331031KX,
Karl Lagerfeld ikonik-print bikini top White KL22WTP14,
Karl Lagerfeld logo-print bikini briefs Brown KL22WBT01,
Karl Lagerfeld logo-print bikini top Red KL22WTP14,
Karl Lagerfeld ring-detail bikini top Brown B1W460342FI,
Karl Lagerfeld K/Signature mid-rise bikini bottoms Grey A1W46022979,
Karl Lagerfeld Choupette-motif crystal-embellished nightdress Pink B1W450031WQ,
Karl Lagerfeld monogram-print triangle bikini top Black A1W46039R57,
Karl Lagerfeld reversible logo-detail leather belt Black A1W33148979,
Karl Lagerfeld logo-waistband briefs (set of seven) Red B1W470162JN,
Karl Lagerfeld script-print bikini bottoms Orange B1W460592UW,
Karl Lagerfeld logo-print triangle bikini top Brown KL22WTP01,
Karl Lagerfeld embellished bikini top Black KL22WTP04,
Karl Lagerfeld monogram-print side-tie bikini bottoms Blue A1W46042,
Karl Lagerfeld ring-detail bikini bottoms Brown B1W460352FI,
Karl Lagerfeld logo-plaque textured bikini bottoms Brown B1W460392FI,
Karl Lagerfeld logo-plaque halterneck bikini top Brown B1W460382FI,
Karl Lagerfeld logo-waistband bikini bottoms Black KL22WBT09,
Moncler cashmere sweatshirt Grey K20939C00008M1223,
Chloé press-crease trousers Purple CH26SPA17061,
Loewe Pre-Owned 2010-2026 X Louis Wain Cats Card Holder coin pouch Brown CLMQ3URSA3S1BI64,
ZIMMERMANN long-sleeve blouse White 8853TS26R,
FRAME Le Slim Palazzo jeans White LSP238P,
LIU JO belted trousers Black WA6274T9257,
MARANT ÉTOILE Iber cut-out gathered top Neutrals HT0827FAD1K05E,
Barbara Bui asymmetric top Brown H4207HXI,
Barbara Bui lace-up blouse White H1426HHN1,
Barbara Bui asymmetric skirt Brown H4210HXI,
Burberry check trim cotton zip hoodie White 8123342,
Love Moschino logo sneakers White JA15065G0OIAH,
Dina Melwani crystal-embellished midi dress Black DMSS26170161,
Joop! Cortina Aena patterned zip wallet Brown 4140006174,
Joop! logo-patch ribbed-knit beanie hat Black 30038491,
Joop! Bellagio Belinda wallet Black 4140008430,
Joop! Strambo Liah shoulder bag Black 4130001273,
Joop! Aitana check print cap White 30100572,
Joop! Adaliz polka-dot fringed-trim scarf Black 30100487,
Joop! Facilita Ivy shoulder bag Black 4130001315,
Joop! logo-print T-shirt White 30034669,
Joop! patterned baseball cap Blue 30046802,
LIU JO ruffled top White WA6365T4853,
IRO Elif leather jacket Green WM137ELIF,
Coach Essential quilted cardholder Neutrals CM434,
ODISSI Cass leather sneakers Pink OD46016A23003,
Victoria Beckham collared midi dress Black 1226KDR007282A,
GANNI studded mules Blue B1030111,
Coach Bleecker leather bucket bag Neutrals CCX07,
Forte Forte floral-print sleeveless waistcoat Neutrals 14802MYJACKET,
GANNI floral-print cargo trousers Grey A1080166,
IRO Sybel T-shirt Green WM19SYBEL,
Nodaleto platform denim pumps Blue NO46015C23060,
Victoria Beckham Eve twist-detail tulip-sleeve midi dress Neutrals 1226WDR005195D9807,
IRO Priam straight-leg trousers Neutrals WM23PRIAM,
IRO Utenia striped asymmetric dress Blue WM33UTENIA,
Furla patterned handle tote bag Neutrals WB00255BX4423,
IRO Malia short-sleeve ddress Black WM33OMALIA,
Alaïa heart-shape crossbody bag Black AA1P003CA577,
Alaïa textured midi dress Blue AA9R3055K195C,
IRO Ekin skirt Green WM31EKIN,
GANNI floral-print heart-shaped mirror charm Blue B3010277,
Coach 28 Brooklyn topstitch leather shoulder bag Brown CW637,
adidas Samba Lx lace-up sneakers Brown HQ9251,
Alaïa zip mini skirt Black AA9J2526W129C,
Victoria Beckham check-pattern pleated shorts White 1226WSR007261C,
Barbara Bui oval buckle belt Brown H6914CRMH18,
Barbara Bui embroidered halterneck top Green H1437REK,
Sisley side-slit jeans White 4UNGLE037,
Sisley pleated cropped trousers Red 4KVXL5CM7,
Juicy Couture embellished straight trousers Blue JCWBJ225307,
Joseph Ribkoff pompom detail beaded beanie Black 253969,
Juicy Couture ribbed-knit logo-pendant hoodie Black JCLBJ125503,
Juicy Couture drawstring embellished track pants Pink JCWBJ225307,
Juicy Couture one-shoulder embellished top Red JCBCT125863,
Juicy Couture zip-up hoodie Pink JCWAS125302,
Juicy Couture lace-trim lounge trousers Pink JCLBJ225508,
Joseph Ribkoff pompom detail beanie Neutrals 253969,
Juicy Couture logo-waistband ribbed trousers Neutrals JCLAS125504,
Juicy Couture drawstring pocket trousers White JCAP180,
Juicy Couture Tamayo Triangle logo-print halterneck swimsuit Pink JCITS125201,
Juicy Couture rhinestone-embellished velour track pants Purple JCWBJ225307,
Juicy Couture Taihiti logo-embroidered triangle bikini Pink JCITS125202,
Juicy Couture logo-print top Black JCBCT125863,
Juicy Couture logo-buckle belt Black WIJJ98537WL7,
Juicy Couture Vicky logo-waistband ribbed pajama trousers Pink JCLAS125504,
Joseph Ribkoff leopard-print faux-fur scarf Brown 253974X,
Juicy Couture embellished straight-leg trousers Green JCWBJ225307,
Hermès Pre-Owned 2019 Clemence Picotin Lock 22 handbag Purple SUR7EGDGY63WBZPL,
Sisley belt-loop jeans Blue 4TTZLE048,
Sisley button cardigan Neutrals 17Q3M5203,
Sisley small zip-detail cross body bag Red 6UKDWY055,
Sisley V-neck cardigan Brown 17Q3L603J,
Sisley crew-neck long-sleeve sweater Black 17Q3M100F,
Sisley buttoned shirt Blue 5E7SLQ0AD,
Sisley pleated trousers Neutrals 4KVXL5CM7,
Sisley boat neck knitwear Black 11BAM1A48,
Sisley straight-leg jeans Blue 4MCPLE046,
Sisley tailored trousers Black 4KVX55AE7,
Sisley belt-loop trousers Green 4K2ZLF03V,
Sisley floral-print high-waist trousers Neutrals 4PYXLF016,
Sisley pinstriped trousers White 4PIKLF056,
Sisley short-sleeve turtleneck sweater Black 1WH2M2025,
Sisley tie-fastening V-neck blouse White 5UUFLQ03Q,
Sisley slim-fit jeans Blue 4TAYLF06G,
Sisley lace-details blouse White 5WTKLQ09X,
Sisley flat-front trousers Neutrals 4KVXLF02I,
Sisley washed-effect jeans Neutrals 4MCPLE045,
Sisley long-sleeve sweater Brown 17Q3M103J,
Sisley lattice-detailing fine-knit sweater Neutrals 1XGYM106I,
Sisley long-sleeve sweater Green 17Q3M103J,
Sisley textured trousers Grey 45FALF086,
Sisley pressed-crease flared trousers Green 4KVXLF02I,
Sisley crew-neck sweater Neutrals 17Q3M100F,
Sisley patterned button-fastening shirt White 5WDJLQFF7,
Sisley belt-loop trousers Green 4KVXLF02I,
Sisley roll-neck sweater Blue 11BAM201C,
Sisley fuzzy scoop neck top Black 19VBMH00E,
Sisley zip-up trousers Black 4AI6LE03G,
Sisley fil-coupé ruched mini dress Green 4TY3LV06N,
Sisley zip-up trousers Grey 4KVXLF02I,
Sisley gathered puff-sleeve shirt Neutrals 5V5TLQ0AE,
Sisley buttoned polo-collar jumper Black 19VBM300B,
Sisley tailored trousers Red 4AI6LE03G,
Sisley dart-detail long-sleeve shirt White 5E7SLQ0AD,
Sisley V-neck button-up cardigan Black 17Q3L603J,
Sisley buttoned round-neck cardigan Neutrals 102HM5237,
Sisley elasticated pleated trousers Black 41YPLF043,
Sisley flared trousers Blue 4KVXLF02I,
Sisley striped trousers Neutrals 4LMTLF08A,
Sisley side-pocket mini shorts Grey 483QL901T,
Sisley zip-up trousers Green 48M855BK7,
Sisley striped trousers Pink 4ZDNLF05F,
Sisley cargo-pocket trousers Brown 44VZLF03Y,
Sisley long-sleeves shirt Black 5IDTLQ08R,
Sisley pleated trousers Black 4KVXLF07C,
Sisley high-waisted trousers Orange 4KVXLF02I,
Sisley classic-collar shirt Blue 5IDTLQ08R,
Sisley pleated trousers Black 4KVXL5CM7,
Sisley geometric-pattern shirt Red 5W4VLQ07F,
Sisley ruffled patterned shorts Red 4D9NL900E,
Sisley striped trousers Grey 4LMTLF08A,
Sisley button V-neck cardigan Green 17Q3L603J,
Sisley ankle-length pinstripe trousers Black 42T7LF07X,
American Vintage Voogy top Orange VOO07BE25,
Karl Lagerfeld logo-plaque halterneck bikini top Grey A1W46021979,
Karl Lagerfeld short-sleeved T-shirt Blue A1W170681KZ,
Karl Lagerfeld monogram-print bikini top White KL20WTP27,
Karl Lagerfeld logo-waistband brazilian briefs (set of seven) Green B1W470172JN,
Karl Lagerfeld logo-print bikini bottoms Black KL21WBT18,
Karl Lagerfeld logo-pattern bikini top Black B1W460582UV,
Karl Lagerfeld monogram-print triangle bikini top Brown B1W460492GY,
LIU JO press-crease jeans Blue UA6180DS083,
LIU JO bootcut jeans Blue UA6025DS085,
Louis Vuitton Pre-Owned 2021-2026 Lambskin Coussin PM satchel Silver 7ZIG3UL37Y3ABDHN,
LIU JO press-crease trousers Neutrals WA6099TS896,
DUNST button zip jacket Neutrals UDJU6A111CR,
Paly long-sleeve T-shirt Red 3U001Q1010,
Love Moschino contrast panel sneakers White JA15065G0OIAH,
Love Moschino logo detail sandals Neutrals JA28383G0OJS0,
Dina Melwani crystal embroidered velvet maxi gown Black DMSS26170167,
Dina Melwani embroidered jacket White DMSS26170163,
Dina Melwani crystal embroidered velvet maxi dress Black DMSS26170165,
Dina Melwani crystal pearl embellished couture maxi dress White DMSS26170164,
Dina Melwani crystal-embellished top and maxi skirt (set of two) Black DMSS26170149,
Dina Melwani crystal-embellished long-sleeve maxi gown Pink DMSS26170145,
Dina Melwani crystal-embellished maxi dress Pink DMSS26170144,
Dina Melwani crystal-embellished top and maxi skirt Neutrals DMSS26170170,
Dina Melwani hand-embroidered stardust tulle maxi gown Pink DMSS26170155,
Dina Melwani strapless crystal maxi gown Black DMSS26170147,
Dina Melwani floral sequin-embroidered jacket-silhouette maxi gown White DMSS26170,
Dina Melwani embroidered tulle maxi dress Neutrals DMSS26170168,
IRO Uzelie sheer-panelled sleeveless cotton top White WM19UZELIE,
Y-3 x Mercedes AMG Feroza sneakers Black KK1824,
ISABEL MARANT small Yenky striped tote bag Blue PM0002FCD1X13M,
ISABEL MARANT tassel studded loafers Black MC030FAD1A18S,
Joop! Cortina Cornflower C-Four card holder Blue 4140006202,
Balenciaga Pre-Owned 2010-2026 XS Leather Everyday Camera Bag crossbody bag Black C23NZXAZLM97VREQ,
Castañer Vallita woven platform sandals Grey 26223,
Just Cavalli chain-strap shoulder bag Black 80RA4BB7ZS766,
CHANEL Pre-Owned 2003-2004 CC Quilted Caviar Wooden Bar shoulder bag Brown 4UGF7ZAJQ3VOBRNC,
Love Moschino heart-charm tote bag Black JC4276PP0OK10,
Just Cavalli woven tote bag Neutrals 80RA4BQ2ZG427,
CHANEL Pre-Owned 2021-2026 Quilted Lambskin Chain hobo bag Blue 036WLEVVMKA5HRZW,
LIU JO V-neck long-sleeve sweater Neutrals WA6286MS46J,
Love Moschino heart-charm tote bag Neutrals JC4273PP0OK10,
The Seller suede sandals Black ME600,
Julie Dee crossover-strap platform-heel sandals Neutrals BE517,
Julie Dee platform-heel crossover-strap sandals Gold BE512,
INBETWEENERS embroidered baseball cap White S5TWUABC059,
Love Moschino logo-detail tote bag White JC4296PP0OKL0,
LIU JO sequin-embellished top White WA6218MA68R,
Love Moschino perforated cross body bag Black JC4291PP0OKK0,
Just Cavalli woven tote bag Neutrals 80RA4BQ1ZG427,
Coperni zip-fastening belt bag Brown COPBE17F6085,
Toccin Evangeline strong-shoulder ruched midi cotton dress Yellow TS6440D129,
Toccin Savannah tailored shorts Green TC6220P004,
Toccin Nina belted culotte shorts Neutrals TS6220P031,
Joop! Cortina Aena Cornflower wallet Blue 4140006174,
Joop! Bellagio Nisa quilted wallet Black 4140008429,
Joop! Cortina Aeana wallet Neutrals 4140006174,
ERES Pulpeux embroidered top White 272636,
ERES Senecio pocket trimmed swimsuit Yellow 012638,
ERES Providence Tonique wireless triangle bra Pink 60985,
ERES Promesse Tonique thong Grey 612518,
ERES Eden Tonique full-cup bra Pink 60986,
ERES Providence Tonique wireless triangle bra Grey 60985,
ERES Calathea trimmed bikini briefs Pink 042628,
ERES Lydia Soyeuse wireless triangle bra Pink 60859,
ERES Jacaranda embroidered mini dress White 202626,
ERES Eden Tonique full-cup bra Grey 60986,
ERES Stapelia contrast-trim bandeau bikini top Pink 032624,
ERES Euphorbia embroidered shorts White 232628,
ERES Canopée tank one-piece swimsuit Pink 012639,
ERES Luxuriance embroidered V-neck midi dress White 202627,
ERES Ilona Soyeuse full-cup bra Pink 60860,
ERES Promesse Tonique thong Pink 612518,
ERES Mika Soyeuse thong Pink 612108,
ERES Brina Soyeuse high-waisted briefs Pink 612110,
ERES Bambin Tonique briefs Grey 612519,
ERES Bambin Tonique briefs Pink 612519,
Louis Vuitton Pre-Owned 2017 Taiga Rainbow Danube crossbody bag Black BOYCIS76XFZF5HLM,
Reebok Instapump panelled sneakers Neutrals 100261808P,
Reebok Premier Road Ultra sneakers Pink 100261768P,
CRAFT Hypervent T-shirt Neutrals C172971050,
Carhartt WIP double-knee skirt Black I0358808906,
Reebok 94 Instapump sneakers Black 100261815,
Reebok Premier Road Ultra sneakers Pink 100261769P,
CRAFT Hypervent shorts Black C175089990,
Castañer Carina ribbon wedge sandals Neutrals 026159,
Just Cavalli chain-strap shoulder bag Neutrals 80RA4BB7ZS766,
Celine Pre-Owned 20th Century Macadam Canvas Camera Bag crossbody bag Brown BRJY8OPI3U8Z6Q67,
Love Moschino heart-charm tote bag Neutrals JC4276PP0OK10,
Castañer Vaia braided platform sandals Brown 26094,
Love Moschino logo charm tote bag Black JC4273PP0OK10,
Love Moschino quilted chain tote bag Black JC4266PP0OKH1,
LIU JO V-neck cardigan Neutrals WA6291MS46J,
The Seller square-toe sandals Brown ME633,
Julie Dee crisscross-strap platform-heel sandals Brown BE517,
Julie Dee platform-heel crossover-strap sandals Neutrals BE512,
The Seller T-bar sandals Silver ME600,
Love Moschino heart cut-out tote bag Black JC4289PP0OKK0,
Love Moschino logo-detail tote bag Neutrals JC4296PP0OKL0,
icebreaker logo-embossed tank top Neutrals IB1032133471,
icebreaker Siren tank top Black IB1032130011,
icebreaker V-neck long-sleeve top Black IB1031940011,
icebreaker graphic-print T-shirt Pink IB0A57CB0GV1,
INBETWEENERS logo-embroidered baseball cap Black S5TWUABC059,
icebreaker logo waistband leggings Grey IB1043830131,
Iceberg graphic-print ribbed-knit tank top Pink T1116302,
icebreaker logo-waistband shorts Black IB0A59KZ0011,
Coperni foam flip flops Green COPSH106F6091,
Love Moschino heart-perforated cross body bag White JC4291PP0OKK0,
Bottega Veneta Pre-Owned 2012-2026 Nappa Intrecciato Wallet on Chain shoulder bag Blue QLZT18M4ALGORD15,
Benetton round-neck sweater Black 1VAAD10F4,
Benetton pocket wide-leg jeans Blue 40M0DE02H,
Benetton flared jeans Green 4WDDDE029,
Benetton ribbed-trim vest Pink 126WD10BA,
Benetton check-pattern fringed scarf Black 62QJDU027,
Benetton button-fastening trousers Green 4SJCDF07J,
Benetton Stranger Things patterned sweater Pink 171RE10EN,
Benetton button trousers Neutrals 4AGHDF08M,
Benetton ribbed-knit sweater Blue 103ME1N23,
Benetton split trousers Green 40V4DF03T,
Benetton side-stripe trousers Black 17Q3DF013,
Benetton ribbed-knit boat-neck sweater Black 16UYD10E7,
Benetton striped polo top White 1294E301D,
Benetton puff-sleeve knitted sweater Blue 1Y6SD2041,
Benetton straight-leg jeans Blue 43UNDE02B,
Benetton crew-neck sweater Green 103ME1N23,
Benetton pleated tailored trousers Black 4E6QDF0AH,
Benetton short-sleeve knitted T-shirt Neutrals 1ZRED10BK,
Benetton crew-neck long-sleeve sweater Grey 103ME1N23,
Benetton cuffed trousers Neutrals 4FRXDF08E,
Benetton patterned high-waisted trousers Grey 4X8MDF07F,
Benetton button trousers Green 4SJCDF09W,
Just Cavalli chain-charm shoulder bag Neutrals 80RA4BE4ZSD85,
CHANEL Pre-Owned 2004-2005 Large Quilted Lambskin Cambon Ligne tote bag Brown HMHOLOCNR4SZQKFQ,
Just Cavalli chain-strap shoulder bag Neutrals 80RA4BB9ZS766,
Ea7 Emporio Armani short-sleeve graphic T-shirt White 8NTT66TJFKZ,
Ea7 Emporio Armani logo-patch hat Pink 4F100280044,
Armani Exchange ASV logo-plaque crop top Black XW000577AF12740,
Armani Exchange sequin-embellished T-shirt Pink 8NYTDLYJ73Z,
Alexander Wang crystal hotfix drawcord balloon jogger Black 4DC2264167015,
JW Anderson cropped stripe-detail shirt Neutrals SH0384PG1898,
Celine Pre-Owned Belt Bag Textured Leather Pico shoulder bag Pink S0LAYBF82FXKUL3F,
Hummel Diamant Lx-E Rs chevron panelled sneakers Neutrals 226230,
Calvin Klein logo shoulder bag Black LV04F3423GUB1,
Calvin Klein all-over patterned shoulder bag Neutrals LV04F3365G3I6,
Calvin Klein patterned shoulder bag Black LV04F3365G2XA,
Retrofete Antoinette floral-pattern trousers Green RSS261248814,
Herschel Supply Co. Classic XL 30L backpack Red 1154607115,
Herschel Supply Co. Wesbrook 24L backpack Black 1167105881,
Herschel Supply Co. Classic XL stickerup-print backpack White 1154607111,
Herschel Supply Co. Kaine 28L mesh-pocket backpack Brown 1167007120,
Herschel Supply Co. Classic XL 30L logo-appliqué backpack Blue 1154607116,
Herschel Supply Co. Classic™ 19 L top-handle tote bag Black 1155000001,
Herschel Supply Co. small Retreat 17L backpack Grey 1140005456,
Miu Miu mesh sneakers Black 5S647EF005CD1,
Carhartt WIP Cane logo-detail bucket hat Blue I036381,
Manebi almond flat sandals Black M61BQBLACK,
Manebi buckle strap flat sandals Brown X29Y0TAN,
Toccin Vik one-shoulder cascade cotton top White TS6440T094,
Love Moschino logo-plaque tote bag White JC4297PP0OKL0,
Benetton flap'-pocket denim shirt Blue 5RZKDQ06T,
Benetton button corduroy trousers Neutrals 4Q5GDF0AI,
Benetton V-neck sweater Black 1VAAD10EX,
Benetton wide-leg jeans Neutrals 4WDDDE029,
Benetton patch pocket jeans Blue 43UNDE02B,
Benetton houndstooth-pattern trousers Neutrals 44BWDF0AA,
Benetton button corduroy trousers Purple 4Q5GDF0AI,
Benetton ribbed long-sleeved sweater Purple 16UYD10E7,
Benetton V-neck sweater Neutrals 1002D4488,
Benetton ribbed sleeveless knitwear Green 126WD10BA,
Benetton crewneck wool sweater Black 1002D1K01,
Benetton houndstooth trousers Purple 44BWDF0AA,
Benetton check fringed scarf Green 62QJDU027,
Benetton embroidered midi dress Blue 4KUSDV0B7,
Benetton printed maxi dress Black 4VET5V02D,
Benetton wide leg trousers Blue 17Q3DF013,
Benetton cuffed cropped trousers Purple 4SJCDF07J,
Benetton elasticated-waist trousers Green 4M3CDF0A8,
Benetton houndstooth trousers Grey 44BWDF0AA,
Benetton elasticated-waistband wide-leg trousers Green 4PAXDF0A4,
Benetton round neck sweater Pink 1002D1K01,
Benetton pleated trousers Blue 4K3ADF09Z,
Benetton pleated trousers Grey 4QIKDF0AC,
Benetton cuffed tapered trousers Neutrals 47CKDF0AZ,
Benetton button-fastening cropped trousers Purple 4SJCDF09W,
Just Cavalli chain shoulder bag Black 80RA4BB9ZS766,
Golden Goose Melody straight-leg jeans Neutrals GWP02079P002351,
Vic Matie buckle leather shoulder bag Neutrals 1K0432T999G010310,
Roberto Collina Smanicato ribbed cut-out top Brown 261FXA31214,
Self-Portrait crystal-embellished bow earrings Silver SS26608EASL,
Roberto Collina Smanicato cut-out ribbed top Black 261FXA31214,
Jil Sander high-waisted slit midi skirt Black J03MA0302J70221,
Ea7 Emporio Armani logo-patch baseball cap Black 4F100280044,
Armani Exchange crew-neck T-shirt Black 8NYT95YJ16Z,
Emporio Armani logo slides Grey XVPS11XR273,
Armani Exchange rhinestone-embelished T-shirt Green XW000387AF10354U7231,
Armani Exchange logo-embroidered cap Purple 9442064R108,
Ea7 Emporio Armani side-logo track pants Blue 8NTP85TJTXZ,
Armani Exchange logo-detail basbeall cap Black XW000873AF13334,
Armani Exchange cropped T-shirt Black XW000546AF10359,
Ea7 Emporio Armani Crusher Distance sneakers White AF186397X000652,
Essentiel Antwerp draped-detail skirt Green JISELLE,
Calvin Klein five-pocket jeans Grey LV047F755GSDA,
Jil Sander button shirt Black J03DL0225J20357,
OUR LEGACY Sasso Stripe Lyocool pocket shirt White W2262SSS,
Hummel printed leggings Grey 230134,
Hoss Intropia Lilit embroidered buckle-fastening belt Green 5023071,
Hoss Intropia Linka buckle belt Brown 5023070,
Hoss Intropia beaded trousers Pink 6542822,
Hoff Myra panelled sneakers Blue 12517002,
Hummel chevron sneakers Yellow 226234,
Louis Vuitton Pre-Owned Saint Sulpice Handbag Monogram Empreinte Leather PM crossbody bag Red R75MLC5OZ858U0ZX,
Celine Pre-Owned Classic Box Bag Smooth Leather Medium crossbody bag Red PKDQV2U8JXWFUT8S,
alice + olivia Alex striped boxy jacket Blue CC603R08210,
Veronica Beard Taylor cropped wide jeans White J2603D411152WH,
Simon Miller knit shorts Black W52724139,
A.L.C. floral knot dress Purple 6DRES02932,
Varley Tansy pleated shorts Neutrals VAR03223,
Louis Vuitton Pre-Owned Montaigne Handbag Monogram Canvas BB satchel Brown O7XZ5EVHOUM8VGA2,
Herschel Supply Co. Retrea 20L quilted tote bag Neutrals 1142006537,
Herschel Supply Co. Kaine logo-patch zipped backpack Blue 1167007119,
Herschel Supply Co. mini Retreat 10L backpack Neutrals 1139805456,
Herschel Supply Co. Retreat padded tote bag Green 1142006561,
Herschel Supply Co. Fleet Skate 28L backpack Black 1166800001,
Birkenstock Gizeh buckle-fastening sandals Neutrals 043751,
Birkenstock Arizona buckled sandals Black 1031771,
Birkenstock Arizona buckled leather sandals Brown 1027039,
Birkenstock Arizona double-strap sandals Neutrals 1019016,
Birkenstock Arizona Big Buckle sandals Silver 1020021,
Birkenstock Arizona buckle-fastening sandals Blue 0051753,
Samantha Sung floral tie maxi dress Blue AUDREYDRESSSHIRTGALERIESUMMERBOUQUETSOFTAQUA,
base button T-shirt White B7724322001,
TOTEME geometric-pattern beach towel Black 243WSW0007FB0256326,
Manebi pointed ballet flats Black M41GFBLACK,
Michael Michael Kors small Izzy shoulder bag Black 32S6GZYC1L,
Samantha Sung tassel floral maxi dress Blue EVA,
The Attico single-breasted blazer Black 260WCG00093WWC002AA,
base crew-neck T-shirt White D16831779201,
Manebi strap flat sandals Black I18Y0BLACK,
base short-sleeve T-shirt White B7821,
Emporio Armani button pleated mini skirt Neutrals EW004379TE20059,
Fusalp Acarim quilted jacket Neutrals J110291400,
Fusalp Miraca quilted gilet Neutrals J110391400,
Fusalp Vera ribbed polo shirt Green F11145060,
Fusalp Talixe logo-patch T-shirt Green J11065060,
Louis Vuitton Pre-Owned Loop Handbag Monogram Jacquard Denim hobo bag Black ZX4S1BAT1ZQQJGTC,
Comme Des Garçons x Hizume wool hat Black GQK602,
Christian Dior Pre-Owned 2005 zip shoulder bag Neutrals 126322,
Christian Dior Pre-Owned 2002 rivet canvas tote bag Black 155451,
DIXIE chevron-knit trousers Green P566A020A,
La Piscine Jelly ballet flats Brown LS261WA001RB001,
OUR LEGACY Gored shorts White W2266GC,
La Piscine perforated ballet flats White LS261WA001RB001,
CHANEL Pre-Owned 22 Chain Quilted Calfskin Medium backpack Black Z51DY0K5VSL8IAEH,
Louis Vuitton Pre-Owned Neverfull Pochette Damier Large pouch Brown IU2SWC3P9PHYR7D9,
New Balance 9060 paneled sneakers White U90608PE,
Celine Pre-Owned Triomphe Shoulder Bag Canvas with Leather Medium crossbody bag Blue IJHXICAS2S7TSISL,
CHANEL Pre-Owned 19 Flap Bag Quilted Tweed and Sequins Medium crossbody bag Multicolour Z025D8UREB7UZUV2,
Gianvito Rossi braided-strap sandals Neutrals G1016270RICXNCSELU,
Gucci Pre-Owned Soho Disco Leather Small crossbody bag Red I5FO3LX2W3EHLL06,
Benetton drawstring pleated trousers Blue 4DI4DF00J,
Benetton flared jeans Black 4OTADE010,
Benetton short-sleeve sweater Black 1KRBD2047,
Benetton striped polo shirt Red 1298E300H,
Benetton button-embellished sweater Neutrals 104HD10CB,
Benetton textured button shirt White 570QDQ0AL,
Benetton chest-pocket shirt White 54KXDQ0CB,
Benetton striped trousers Neutrals 49KBDF091,
Benetton concealed-fastening flared trousers Grey 4ONGDF034,
Benetton ribbed trousers Neutrals 102HDF00Z,
Benetton button-down embellished cardigan Black 1LPRD605A,
Benetton boat-neck sweater Blue 1C19D10G1,
Benetton chevron-knit sweater Grey 1VUDE10EP,
Benetton button straight trousers Green 4NPHDF09D,
Benetton ribbed crewneck sweater Pink 1C19D10G1,
Benetton buttoned short-sleeved shirt Black 5BML5QB75,
Niccolo Paqualetti Carico pocket hooded jacket Brown NP09J065,
Alexander Wang crystal drawcord balloon joggers Blue 4DC2264165,
Goyard Pre-Owned Saint Louis Coated Canvas GM tote bag Grey GVL1CLT6YQTYGYVC,
GANNI heart bag charm White B3010241,
GUESS USA seam trousers Black V6RB20KD822,
GUESS USA logo-patterned track pants Pink V5YB20KB212,
GUESS USA By Your Side crystal-embellished cuff bracelet Gold JUBB06084JW,
GUESS USA logo-underband cross-back bra Neutrals V5BP02K1942,
GUESS USA logo-plaque track pants Neutrals V5BB03K1971,
GUESS USA logo-embroidery track pants Neutrals V5YB02KB3P2,
GUESS USA logo track pants Black V6RB15K9V31,
GUESS USA L.O.V.E bracelet Gold JUBB05456JW,
GUESS USA logo-waistband leggins Neutrals V5GB04KCSA2,
GUESS USA Mamounia necklace Gold JUBN05569JW,
GUESS USA side-pockets trousers Brown V6RB15K9V31,
GUESS USA regular-fit side-stripe track pants Black V5YB02KB3P2,
GUESS USA drawstring embellished trousers Blue V3BB27KBXI2,
GUESS USA velvet track pants Neutrals V3BB26K0232,
GUESS USA drawstring-waist wide-leg trousers Neutrals V6RB21WL232,
GUESS USA logo-detail track pants Neutrals V2YB18K7UW2,
GUESS USA logo-plaque wide-leg trousers White V4YB07KCAY2,
GUESS USA cargo-pocket trousers Black V4BB12K7UW2,
GUESS USA interlocking heart earrings and necklace (set of two) Silver JUBS06010JW,
GUESS USA Love Bites infinity-motif crystal-embellished jewellery set Silver JUBS06009JW,
GUESS USA side-tape track pants Neutrals V5YB02KB3P2,
GUESS USA Jrixie stripe panel sneakers Neutrals FLPJRXFAB12,
GUESS USA logo-detail track pants Neutrals V4BB13K7UW2,
GUESS USA logo detail trousers Pink V3RB21K7UW2,
GUESS USA lace scalloped-edge bra and thong set Black O5BG03PZ01C,
GUESS USA Iconique necklace Gold JUBN05545JW,
GUESS USA cargo track pants Pink V4BB12K7UW2,
GUESS USA Nat drawstring trousers Black V6RB21WL232,
GUESS USA crystal-embellished heart-detail necklace Gold JUBN05526JW,
GUESS USA logo-print track pants Neutrals V2YB15KB3P2,
GUESS USA drawstring wide-leg trousers Neutrals V6RB17K9V31,
GUESS USA wide-leg track pants Neutrals V6RB03KD761,
GUESS USA Beloved crystal-embellished heart earrings Silver JUBE06004JW,
GUESS USA logo-waistband leggings Black V5BB06K1942,
GUESS USA logo-embellished pendant necklace Silver JUBN05441JW,
GUESS USA Prescilla fitted trousers Brown W4BB18WGIK0,
GUESS USA Chandelier crystal-embellished box-chain necklace Silver JUBN05358JW,
GUESS USA crystal-embellished heart-pendant necklace Gold JUBN05530JW,
GUESS USA logo-tape track pants Brown V2YB15KB3P2,
GUESS USA logo-detail sweatpants Pink V3RB21K7UW2,
GUESS USA rhinestone-embellished logo-script pajamas White O5BX21K3352,
GUESS USA side-detail track pants Brown V2YB15KB3P2,
GUESS USA heart-motif drop earrings Gold JUBE06072JW,
Saint Laurent Cassandre diamond-quilted card holder Grey 862430AAGA8,
Goyard Pre-Owned Anjou Reversible Tote Coated Canvas Mini satchel Black UQKQLU8RCSYSP1XY,
Valentino Garavani Rockstud Spike medium suede gag Brown WB0122KQQ,
GUESS USA logo-studded cotton sweatshirt White W6RQ16KB681,
GUESS USA Peony piped mini dress Black V5YK00KCX12,
GUESS USA Emmie button ribbed top Neutrals W5YR10Z0130,
GUESS USA ribbed buttoned sweater Black W6RR26Z3HP2,
GUESS USA Hana crew-neck sweater Neutrals W6RR57Z2YJ2,
GUESS USA Teodora T-shirt Neutrals W5BP09K68D2,
GUESS USA triangle-logo high-neck mini dress Black V6RK04J1314,
GUESS USA logo-tape drawstring-fastening shorts Purple V3GD13KB3P2,
GUESS USA zip up hoodie Black V5RQ20KC3D2,
GUESS USA Katelyn ribbed-knit pencil skirt Red W5RD15Z2V62,
GUESS USA drawstring mini skirt Black V5YD03KBSL2,
GUESS USA high-neck logo-plaque sweatshirt Neutrals V4YQ05KCAY2,
GUESS USA Raissa floral-pattern mini skirt Pink W5RD68WGLO2,
GUESS USA logo-embellished hoodie Neutrals V4RQ25K0232,
GUESS USA ribbed sweatshirt Black W5YR08Z0040,
GUESS USA long-sleeve T-shirt White W5YI26J1314,
GUESS USA tie-dye logo bodysuit Blue W5YP16K49A1,
GUESS USA logo zip sweatshirt Black V2YQ17K7UW2,
GUESS USA Primula logo-detail cotton hoodie Neutrals V5GQ09KCRP0,
GUESS USA Kadelyn gathered-detail long-sleeve top Black W6RP04KBAH2,
GUESS USA Audrine blouse Black W5BH84W3022,
GUESS USA Audrine blouse Blue W5BH84W3022,
GUESS USA shoulder long-sleeved top Black W5BP08K1492,
GUESS USA V-neck tank top White W5YP52KCYW2,
GUESS USA ribbed mini skirt Red W5RD83Z2Y50,
GUESS USA zip-up hoodie Neutrals V5RQ20KC3D2,
GUESS USA logo patterned top Blue W3YR26Z37K0,
GUESS USA Primula zip-up cotton hoodie Yellow V5GQ10KCRP0,
GUESS USA Elyana T-shirt Brown W5BP28KCSZ2,
GUESS USA pleated mini skirt Neutrals W5RD0OWGX02,
GUESS USA 4G embellished short-sleeve T-shirt Blue W5YI14I3Z14,
GUESS USA cable-knit mini skirt Blue W5YD68Z3OU0,
GUESS USA ribbed-knit crop top White V5BP05Z3JD2,
GUESS USA Helena T-shirt Green W5YR16Z3OV0,
GUESS USA rhinestone-logo zip-up hoodie White V5GQ10KCRP0,
GUESS USA leopard-print long-sleeve mini dress Neutrals W4YK83KBBF2,
GUESS USA logo zip-up hoodie Neutrals V5BQ11KB681,
GUESS USA logo-embellished T-shirt Neutrals W5YR25Z2NQ2,
GUESS USA Flaminia ribbed top Neutrals V5BP05Z3JD2,
GUESS USA logo sweatshirt Neutrals V5BQ10KB681,
GUESS USA striped sweater Blue W6RR58Z2YK2,
GUESS USA rhinestone-embellished hoodie Pink V4RQ25KBXI2,
GUESS USA sequin short-sleeve T-shirt Black W5YR25Z2NQ2,
GUESS USA logo-appliqué sweatshirt White V2YQ17K7UW2,
GUESS USA Reina knitted top Neutrals W5GR40Z3NX0,
GUESS USA ribbed short-sleeve T-shirt Black W5YP14KAQL2,
GUESS USA zipped rhinestone-embellished top Black V3BQ22K0232,
GUESS USA Milena long-sleeve top Black W6RP11KAQL2,
GUESS USA Peony hoodie White V5YQ04KBSL2,
GUESS USA bow ribbed sweater Blue W6RR13Z2YJ2,
GUESS USA button-embellished ribbed top Blue W5YR12Z0130,
GUESS USA rhinestone-logo sweatshirt Pink V4BQ15K7UW2,
GUESS USA logo-detail T-shirt Green W5YP14KAQL2,
GUESS USA crewneck dropped-shoulders sweatshirt Neutrals V3BQ16KB3P2,
GUESS USA Callida polo shirt Black W5BP31KCSZ2,
GUESS USA ribbed buttoned T-shirt Neutrals W5YP12KCTC2,
GUESS USA logo tape zip sweatshirt Neutrals V2YQ16KB3P2,
GUESS USA striped sweater Pink W5GR14Z3MS0,
GUESS USA rhinestone-detail zip-up sweatshirt Neutrals V3BQ22K0232,
GUESS USA zip-up mock-neck sweatshirt Green V2YQ17K7UW2,
GUESS USA Melanie jumper White W5BR48Z0612,
GUESS USA turtleneck vest White W5BR57Z3BH0,
GUESS USA logo-embellished hoodie Orange V5GQ10KCRP0,
GUESS USA contrast-trim V-neck sweater White W6RR26Z3HP2,
GUESS USA monogram-pattern knit skirt Green W4BD53Z37K0,
GUESS USA Khloe crystal-embellished tank top White W5GR47Z3MN2,
GUESS USA zipped hoodie Black V4YQ06KCAY2,
GUESS USA logo-embellishment sweatshirt Neutrals V3BQ16KB3P2,
GUESS USA Erynn cable-knit ribbed top Neutrals W5GR34Z3M00,
GUESS USA triangle appliqué top Neutrals V4YQ05KCAY2,
GUESS USA patterned long-sleeved top Neutrals W6RP46KA660,
GUESS USA floral-print studded T-shirt Neutrals W5BI29J1314,
GUESS USA fringed mini shorts Black W5YD1RZ0201,
GUESS USA Nat ribbed racerback tank top White V6RP09KD932,
GUESS USA Clouis shirt Neutrals W5YH0XWDW82,
GUESS USA monogram-print button-up shirt Purple W4YH47WF1T2,
GUESS USA logo sweatshirt Grey V5BQ05K1971,
GUESS USA Kassade one-shoulder long-sleeve top Brown W6RP02KC1J2,
GUESS USA button-detail top Neutrals W6RP08KCBO2,
GUESS USA zip-up sweatshirt Neutrals V4BQ14K7UW2,
GUESS USA Aurelia sweatshirt Black V5BQ05K1971,
GUESS USA patterned tank top Neutrals V5YP11MC03W,
GUESS USA logo-embellished sweatshirt Pink V4BQ15K7UW2,
GUESS USA Eveline bodysuit Black O4BM16KCDE0,
GUESS USA logo-embellished round-neck sweatshirt Neutrals W6RQ13KD332,
GUESS USA embellished-logo sweatshirt Black W6RQ16KB681,
GUESS USA patterned collared shirt Neutrals W4YH47WF1T2,
GUESS USA logo-embossed hoodie Black V5YQ04KBSL2,
GUESS USA logo-embellished sweatshirt Blue V4BQ15K7UW2,
GUESS USA rhinestone-embellished hoodie Black V4RQ25K0232,
GUESS USA Peony hoodie Neutrals V5YQ04KBSL2,
GUESS USA logo-detail hoodie White V2YQ18K7UW2,
GUESS USA Emmie ribbed-knit button top Blue W5YR10Z0130,
GUESS USA 4G embellished balloon-sleeve sweatshirt Green W6RQ13KD332,
GUESS USA logo-tape cropped sweatshirt Orange V3BQ16KB3P2,
GUESS USA mini pleated skirt Brown W6RD13WH9Y2,
GUESS USA Muriel hoodie Neutrals V5BQ14KCX52,
GUESS USA striped-trim cable-knit vest White V5GR00Z3FB1,
GUESS USA rhinestone-embellished zip-up sweatshirt Pink V4BQ14K7UW2,
GUESS USA off-shoulder long-sleeve top Grey W5BR48Z0612,
GUESS USA graphic-print T-shirt Neutrals W5YI32K9RM1,
GUESS USA Nunzia top Brown W6RH03WJ472,
GUESS USA Nunzia sweetheart-neckline tank top Black W6RH03WJ472,
GUESS USA racerback ribbed tank top Black V6RP09KD932,
GUESS USA velvet panel sweatshirt Black V5BQ10KB681,
GUESS USA button ribbed top Green W5YR12Z0130,
GUESS USA logo-print hoodie Pink V5GQ16KCRQ0,
Hermès Pre-Owned 2015 top handle leather handbag Brown 156047,
GUESS USA metallic-effect side-slit beach skirt Blue E5GD07KC632,
GUESS USA square-buckle belt Neutrals BW9245P5370,
GUESS USA ring-detail bikini bottoms Neutrals E4GO11KC632,
GUESS USA zip make up bag Black PW7552P6136,
GUESS USA embellished scarf Black W5BZ21Z2NQ2,
GUESS USA crystal-embellished logo-buckle belt Grey BW9277P5420,
GUESS USA monogram-pattern logo-print scarf Brown W4BZ22Z3JD2,
GUESS USA logo-patch ruched bikini top Brown E4GJ16KC632,
GUESS USA logo-buckle belt Black W5BZ11L0491,
GUESS USA Lexie logo-embroidered ribbed scarf Neutrals W5BZ19Z3580,
GUESS USA Carrie monogram logo-plaque belt Brown BW9335P6130,
GUESS USA wool blend scarf Neutrals W4BZ22Z3JD2,
GUESS USA logo-buckle belt Black BW9259P5335,
GUESS USA glitter-effect triangle bikini top Purple E4GJ18KC632,
GUESS USA logo-jacquard scarf Neutrals AW5279COT03,
GUESS USA ribbed-knit logo-embroidered scarf Black W5BZ19Z3580,
GUESS USA Marsha Saffiano zip wallet Neutrals SWBG9501140,
GUESS USA Karnilla 4G logo-buckle belt Neutrals BW9334P6130,
GUESS USA triangle bikini top Pink E4GJ18KC632,
GUESS USA Laurel 4G logo-print zip-around maxi wallet Grey SWSG7459146,
GUESS USA Laurel monogram-print logo-plaque wallet Neutrals SWSG7459146,
GUESS USA monogram-print logo-plaque belt Neutrals BW9335P6130,
GUESS USA logo-pattern scarf White W4BZ22Z3JD2,
GUESS USA ruched ring-detail bikini top Pink E4GJ16KC632,
GUESS USA logo-print side-tie bikini bottoms Orange E5GO21KCRL2,
GUESS USA monogram-print ring-detail bikini bottoms Green E5GO27KCRL2,
GUESS USA quilted cardholder and keychain set Black GFBOXWP6202,
GUESS USA quilted wallet Neutrals GFBOXWP6202,
GUESS USA metallic-ring bikini bottoms Brown E4GO11KC632,
GUESS USA paisley-print bikini Orange E5GJ18KCR52,
GUESS USA logo-plaque halterneck bikini top Black E5GJ49MC04R,
GUESS USA logo-tape cross body bag Red V5BZ08WF660,
GUESS USA large Carrie 4G wallet Brown SWGP9898146,
GUESS USA Brenton pebbled-effect wallet Black SWPG9648146,
GUESS USA shimmer-effect triangle bikini top Brown E4GJ18KC632,
GUESS USA Arnela logo-buckle belt Silver BW9192P5115,
GUESS USA rhinestone-embellished side-tie bikini bottoms Black E5GO11MC040,
GUESS USA rhinestone-embellished triangle bikini top Blue E4GJ07KC5Z0,
GUESS USA bow-detail halterneck bikini top Purple E5GJ55LY00K,
GUESS USA ring-detail bikini bottoms Orange E4GO11KC632,
GUESS USA glitter-effect triangle bikini top Blue E4GJ18KC632,
GUESS USA paisley-print triangle bikini top Green E5GJ18KCR52,
GUESS USA logo-embellished triangle bikini top Black E5GJ13MC040,
GUESS USA logo-print bikini top Neutrals E5GJ37KCRL2,
GUESS USA shimmer-effect bikini top Pink E4GJ18KC632,
Michael Michael Kors medium Jet Set Travel tote bag Black 30S6GTVS8L001,
Louis Vuitton Pre-Owned Petit Sac Plat Bag Monogram Canvas crossbody bag Brown LUIKQU18FLNUDWZS,
Louis Vuitton Pre-Owned Papillon Trunk Bag Monogram Canvas shoulder bag Brown LIDIKLHLOY6J628U,
Fusalp Jadou ribbed T-shirt Green H11125060,
Fusalp Kasima hooded jacket Green J10015066,
Fusalp Nirael high-waisted leggings Green J15035066,
Fusalp Elandine logo-patch gilet Neutrals J11011091,
Fusalp Hilde zip-pocket trousers Black J151001000,
The Frankie Shop Linda flap-pocket jumpsuit Grey JLFS215241070102,
Comme Des Garçons wool fedora hat Black GQK601,
adidas Samba fold-over tongue sneakers Neutrals IH9045,
New Balance 5030 sneakers Black U50307G4,
OUR LEGACY Forever plaid-pattern shirt Neutrals W2262FSC,
Christian Dior Pre-Owned 2005 abstract-pattern shoulder bag Neutrals 145858,
Fendi Pre-Owned 1990-2000s Mamma Baguette shoulder bag Neutrals 126296,
Louis Vuitton Pre-Owned 2007 denim patchwork handbag Blue 116821,
Christian Dior Pre-Owned 2001 top-handle handbag Black 145298,
Christian Dior Pre-Owned 2005 Flight tote bag Brown 126124,
Gucci Pre-Owned Dionysus Bag Blooms Print GG Coated Canvas Mini shoulder bag Brown J83WMEVXAVDF0QPB,
Givenchy Pre-Owned Moon Cut Out Bag 4G Coated Canvas Small hobo bag Neutrals YKBE59YISNZVZL62,
Goyard Pre-Owned Compagnon Universel A4 Bag Coated Canvas business bag Grey IEKHLMRRR32UKLPL,
Off-White Be Right Back fishnet sneakers Blue OWIA289S26FAB0047451,
DIXIE logo-detail trousers Neutrals P056A037A,
DIXIE abstract-print cotton shirt Neutrals CFGN1CMA,
Niccolo Paqualetti Panello V-neck top White NP09T058,
Benetton v-neck knitwear Black 126WD402Z,
Benetton frayed jeans Brown 48UHDE02M,
Benetton buttoned sweater White 12F3D5028,
Benetton laminated jeans Grey 48UHDE02M,
Benetton patch-pocket jeans Blue 44NMDF0AL,
Benetton wide-leg jeans Blue 44NMDF0AL,
Benetton boat-neck knitwear Blue 1C19D10G1,
Benetton V-neck long-sleeve top Blue 5RZKDQ0BD,
Benetton buttoned knit cardigan Green 1C19D502P,
Benetton pinstripe-pattern buttoned vest Blue 2X8MDJ00O,
Benetton houndstooth-pattern trousers Pink 44BWDF0AE,
Benetton houndstooth pleated trousers Grey 44BWDF0AE,
Benetton slit-pocket crop flared trousers Green 4YVXDF0A9,
Benetton button cardigan Green 1C19D502P,
Benetton loose-fit sweater Black 18L4E10EW,
Benetton long-sleeve sweater Blue 1Y6SD10EG,
Benetton frayed denim jeans Blue 4OTADE010,
Benetton pleated palazzo pants Green 4LEDDF09O,
Benetton button V-neck knitwear Black 104HD402A,
Benetton pleated trousers Neutrals 44BWDF0AE,
Benetton colour-block zip-up sweatshirt Black 330X3M07O,
Benetton raglan-sleeve crew-neck sweatshirt Purple 1Y6SD10EG,
Benetton raglan-sleeve sweater Green 1Y6SD10EG,
Benetton button-up patch-pocket cardigan Grey 11AHD604R,
Benetton crew-neck cardigan Pink 1C19D502P,
Benetton knitted sweater Blue 1C19D10G1,
Benetton buttoned trousers Purple 4L4H557R4,
Benetton straight-leg trousers Grey 41ACDE01H,
Benetton ribbed trousers Black 1194DF00T,
Benetton crew-neck sweater Yellow 1C19D10FV,
Benetton corduroy flared trousers White 4NIADF05H,
Niccolo Paqualetti Luna pocket trousers Neutrals NP05P039,
Louis Vuitton Pre-Owned Loop Handbag Monogram Canvas hobo bag Brown VV6MD6B82MKYNCWH,
Christian Dior Pre-Owned Lady Dior Bag Wicker and Oblique Canvas Medium tote bag Blue VQUNT8KLQSIN03FQ,
GUESS USA rhinestone logo trousers Black V4BB13K7UW2,
GUESS USA Prescilla trousers Black W4BB18WGIK0,
GUESS USA Roberta elasticated-waist trousers Neutrals W5YB01WH9Y2,
GUESS USA Dora wide-leg track pants White V5BB11K1981,
GUESS USA drawstring wide-leg track pants Neutrals V6RB17K9V31,
GUESS USA seam trousers Neutrals V6RB20KD822,
GUESS USA crystal-embellished heart-pendant earrings Silver JUBE04495JW,
GUESS USA crystal-embellished heart-pendant earrings Silver JUBE05021JW,
GUESS USA logo track pants Pink V4BB13K7UW2,
GUESS USA crystal-embellished G-logo necklace Gold JUBN05437JW,
GUESS USA crystal-embellished flower bracelet Gold JUBB06029JW,
GUESS USA drawstring track pants Grey V6RB17K9V31,
GUESS USA striped track pants Black V5BB24KCX22,
GUESS USA Beloved heart-charm beaded bracelet Gold JUBB06091JW,
GUESS USA silver-tone logo trousers Neutrals V6RB15K9V31,
GUESS USA Nat drawstring track pants Brown V6RB17K9V31,
GUESS USA Beloved heart chain bracelet Gold JUBB06012JW,
GUESS USA heart-pendant chain necklace Gold JUBN04610JW,
GUESS USA AELIA drawstring track pants Pink V5BB10KB681,
GUESS USA logo stripe trousers Neutrals V2YB15KB3P2,
GUESS USA pattern-trim track pants White V2YB15KB3P2,
GUESS USA logo-plaque palazzo pants Brown V4YB07KCAY2,
GUESS USA Aelia track pants Black V5BB10KB681,
GUESS USA elasticated-waistband track pants Pink V4BB13K7UW2,
GUESS USA cargo-pocket track pants White V4BB12K7UW2,
GUESS USA lace-overlay logo-plaque bra Red O5BC17KCQ30,
GUESS USA Beloved heart-embellished necklace and earrings set Silver JUBS06000JW,
GUESS USA heart-chain bracelet Silver JUBB04496JW,
GUESS USA Primula elasticated-waistband track pants Pink V5YB17KCRP0,
GUESS USA logo-plaque track pants Black V4YB08KCAY2,
GUESS USA stripe detail track pants Neutrals V5BB17KCX52,
GUESS USA Peony drawstring track pants Neutrals V5YB06KBSL2,
GUESS USA Maya floral-lace underwired bra Green O5GC15KCQC0,
GUESS USA drawstring logo-patch track pants White V3RB21K7UW2,
GUESS USA Alba logo-waistband leggings Neutrals V5BB06K1942,
GUESS USA side-logo stripe leggings Pink V2YB14KABR0,
GUESS USA interlocking heart necklace Silver JUBN04616JW,
GUESS USA Love Bites necklace and earrings set Gold JUBS06010JW,
GUESS USA heart necklace Silver JUBN05471JW,
GUESS USA Beloved crystal-embellished heart-pendant bracelet Silver JUBB05016JW,
GUESS USA rhinestone-logo T-shirt and briefs set Black O5BG00K1740,
GUESS USA cargo pocket trousers White V4BB12K7UW2,
GUESS USA crystal-embellished drop earrings Gold JUBE05362JW,
GUESS USA crystal-embellished heart necklace Gold JUBN05549JW,
GUESS USA drawstring trousers Neutrals V5BB10KB681,
GUESS USA logo-embossed drawstring track pants Pink V3RB21K7UW2,
GUESS USA wide-leg track pants Black V6RB03KD761,
GUESS USA crystal-embellished G-logo necklace Gold JUBN05441JW,
GUESS USA Essenza embellished hoop earrings Gold JUBE06020JW,
GUESS USA JRIXIE sneakers Black FLPJRXFAB12,
GUESS USA embellished pendant necklace Silver JUBN04501JW,
Bottega Veneta Pre-Owned Wallace Intrecciato Nappa Mini shoulder bag Green FVGFEEO5VODYI33H,
Carhartt WIP Cloud Heart beach towel Black I036362,
Valentino Garavani Jean medium shopping bag in nappa with chevron motif Black WB0T79KID,
Valentino Garavani Rockstud laminated nappa wedge sandal 95 mm Gold WS0F95ULR,
adidas Barreda Decode sneakers Brown JR3519,
adidas side-stripe track pants Blue JC8145,
CAFÉ KITSUNÉ fox-appliqué sweatshirt Black OU00301KM0330,
CAFÉ KITSUNÉ logo-print scented candle Neutrals CKMU08403O0003,
CAFÉ KITSUNÉ logo-patch T-shirt Green CKNU00102KJ7014,
Louis Vuitton Pre-Owned Trio Messenger Bag Reverse Monogram Eclipse Canvas crossbody bag Black TZH010UT0JKJ869F,
GUESS USA logo-detail mini dress Neutrals V6RK04J1314,
GUESS USA long-sleeved T-shirt Neutrals W5RR01Z2YK2,
GUESS USA Anita T-shirt Black W5BP08K1492,
GUESS USA logo-embroidered short-sleeve dress Neutrals V4YK02KCDH1,
GUESS USA Naleny top Brown W5YP18KCYE2,
GUESS USA Hanna ribbed sweater Green W5YR08Z0040,
GUESS USA monogram-pattern tank top Blue W3YR26Z37K0,
GUESS USA striped buttoned shirt Blue W5YH47WHD10,
GUESS USA rhinestone-embellished short-sleeve T-shirt Black W5BI18I3Z14,
GUESS USA Misty sweatshirt Grey V5RQ13KCOS1,
GUESS USA twist-front ruched T-shirt Neutrals W5GP15KACM2,
GUESS USA 4G rhinestone-embellished T-shirt White W5YI14I3Z14,
GUESS USA Kiara embellished-logo sweater Black W5YR23Z2NQ2,
GUESS USA Sofia embroidered logo-lettering sweatshirt Neutrals O5RQ03KCO31,
GUESS USA Zanita pinstriped mini skirt Black W5BD64W2422,
GUESS USA zip-up hoodie Black V5BQ11KB681,
GUESS USA Fabia sweatshirt Red V5BQ03KCX22,
GUESS USA Charlotte twisted T-shirt Green W5GP15KACM2,
GUESS USA Raissa square-neck crop top Black W5RH26WGLO2,
GUESS USA ribbed-knit flared-sleeve sweatshirt Black W5YR13Z3OT0,
GUESS USA Aubrey 4G logo-print mini skirt Brown W5BD81Z3JD2,
GUESS USA zip-up sweatshirt Blue V3BQ22KBXI2,
GUESS USA frayed denim shorts Blue W5GD74D5B96,
GUESS USA embroidered sweatshirt Black V5RQ12KC3D2,
GUESS USA patterned high-neck tank top Neutrals W3YR26Z37K0,
GUESS USA triangle-logo funnel-neck sweatshirt Black V4YQ05KCAY2,
GUESS USA Koryn cut-out crop top Black W6RP53K9SV2,
GUESS USA Lauriane shirt White W5YH47WHD10,
GUESS USA textured ring-detail T-shirt Black W5YR16Z3OV0,
GUESS USA zip-up hoodie Neutrals V5BQ11KB681,
GUESS USA pinstripe mini skirt Blue W5BD64W2422,
GUESS USA one-shoulder long-sleeve top Red W6RP02KC1J2,
GUESS USA logo-tape zip-up sweatshirt Neutrals V2YQ16KB3P2,
GUESS USA logo-embellished sweatshirt Black V4BQ15K7UW2,
GUESS USA asymmetric-neck long-sleeved top Neutrals W6RP03KACM2,
GUESS USA embroidered long-sleeved T-shirt Black W5YR22Z2NQ2,
GUESS USA Mylah zip-up sweatshirt White V4GQ02KBFB2,
GUESS USA logo-detail midi skirt Black W5BD84W2362,
GUESS USA zip-up jacket Neutrals V3BQ22K0232,
GUESS USA logo-embellished hoodie Neutrals V4RQ25K0232,
GUESS USA button-embellished sweater Neutrals W6RR07Z2YK2,
GUESS USA logo-print T-shirt Black V6RP08KD932,
GUESS USA rhinestone-embellished zip-up sweatshirt Blue V3BQ22K0232,
GUESS USA logo-detail T-shirt Neutrals W5YP14KAQL2,
GUESS USA logo-detail tank top Black V5BP05Z3JD2,
GUESS USA cable-knit fitted skirt Neutrals W5YD68Z3OU0,
GUESS USA racerback ribbed top Brown V6RP09KD932,
GUESS USA Raissa floral-print top Neutrals W5RH26WGLO2,
GUESS USA Joey knotted top Black W5YP33KACM2,
GUESS USA rhinestone-embellished zip-up sweatshirt Pink V4BQ14K7UW2,
GUESS USA zip-up sweatshirt Blue V2YQ17K7UW2,
GUESS USA logo-tape sweatshirt Black V3BQ16KB3P2,
GUESS USA rhinestone-embellished zip-up sweatshirt Neutrals V3BQ22K0232